Property Summary

NCBI Gene PubMed Count 18
PubMed Score 68.89
PubTator Score 32.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.600 2.1e-04
pilocytic astrocytoma 1.200 1.5e-04
ovarian cancer -1.700 1.7e-06

Gene RIF (3)

PMID Text
25173105 Data indicate three loci associated with primary open-angle glaucoma (POAG) were located upstream of ATP binding cassette transporter 1 (ABCA1), within actin filament associated protein 1 (AFAP1) and within GDP-mannose 46-dehydratase (GMDS).
23333711 Methylation of the long noncoding RNA AFAP1-AS1 is reduced in BE and EAC, and its expression inhibits cancer-related biologic functions of EAC cells.
17520695 AFAP-110 is required for actin stress fiber formation and cell adhesion in MDA-MB 231 breast cancer cells.

AA Sequence

MEELIVELRLFLELLDHEYLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEI      1 - 70
PQPWLPPDSGPPPLPTSSLPEGYYEEAVPLSPGKAPEYITSNYDSDAMSSSYESYDEEEEDGKGKKTRHQ     71 - 140
WPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTKLLCYKSSKDQQPQMELPLQGCNITYIPKDS    141 - 210
KKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKAELEKKLSSER    211 - 280
PSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPT    281 - 350
CGYLNVLSNSRWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAV    351 - 420
LEASSSEDMGRWIGILLAETGSSTDPEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISANPYLGGTSNG    421 - 490
YAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNAAQYKYGKNRV    491 - 560
EADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILEEKLKQLEEECRQKEAERV    561 - 630
SLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAV    631 - 700
LKKSQAAPGSSPCRGHVLRKAKEWELKNGT                                            701 - 730
//

Text Mined References (30)

PMID Year Title
25173105 2014 Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23333711 2013 Hypomethylation of noncoding DNA regions and overexpression of the long noncoding RNA, AFAP1-AS1, in Barrett's esophagus and esophageal adenocarcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17885682 2007 AFAP-110 is overexpressed in prostate cancer and contributes to tumorigenic growth by regulating focal contacts.
17520695 2007 AFAP-110 is required for actin stress fiber formation and cell adhesion in MDA-MB-231 breast cancer cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485829 2004 Conversion of mechanical force into biochemical signaling.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14755689 2004 Analysis of the role of the leucine zipper motif in regulating the ability of AFAP-110 to alter actin filament integrity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12134071 2002 PC phosphorylation increases the ability of AFAP-110 to cross-link actin filaments.
11641786 2001 The intrinsic ability of AFAP-110 to alter actin filament integrity is linked with its ability to also activate cellular tyrosine kinases.
11607843 2001 The actin filament-associated protein AFAP-110 is an adaptor protein that modulates changes in actin filament integrity.
10666339 2000 The carboxy terminus of AFAP-110 modulates direct interactions with actin filaments and regulates its ability to alter actin filament integrity and induce lamellipodia formation.
9655255 1998 Formation of a stable src-AFAP-110 complex through either an amino-terminal or a carboxy-terminal SH2-binding motif.
9619827 1998 Src can regulate carboxy terminal interactions with AFAP-110, which influence self-association, cell localization and actin filament integrity.
7545969 1994 Isolation and characterization of 21 novel expressed DNA sequences from the distal region of human chromosome 4p.