Property Summary

NCBI Gene PubMed Count 21
PubMed Score 37.00
PubTator Score 24.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
interstitial lung disease 1.200 4.1e-02
malignant mesothelioma 4.800 1.2e-09
psoriasis -1.600 4.4e-04
astrocytoma 1.100 3.7e-04
glioblastoma multiforme 2.200 5.2e-17
ependymoma 1.700 1.1e-04
cystic fibrosis -1.080 3.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.095 2.9e-02
adrenocortical carcinoma -1.352 4.4e-03
primary pancreatic ductal adenocarcinoma 2.254 2.9e-04
intraductal papillary-mucinous adenoma (... -1.400 1.9e-03
intraductal papillary-mucinous carcinoma... -1.700 1.8e-03
pancreatic cancer 2.500 8.4e-05
adult high grade glioma 1.800 2.4e-03
pilocytic astrocytoma 2.100 2.7e-06
subependymal giant cell astrocytoma 1.785 3.9e-02
invasive ductal carcinoma 1.455 1.2e-02
inflammatory breast cancer 2.200 1.7e-02
lung carcinoma -1.200 4.0e-10
gastric carcinoma 2.000 1.5e-02
ovarian cancer 3.000 1.2e-06
pituitary cancer -1.900 1.2e-06

Gene RIF (7)

PMID Text
24344132 ACLP stimulates the fibroblast-to-myofibroblast transition by promoting SMA expression via TGFbeta signaling and promoting collagen expression through a TGFbeta receptor-independent pathway.
22821744 There is no statistically significant differences in the frequency of variants in AEBP1 among the gastroschisis case group compared to a Caucasian control group.
22723309 Both cellular proliferation and survival were affected in AEBP1-silenced U87MG and U138MG cell lines and a significant percentage of these cells were directed towards apoptosis.
20419060 This review focuses on the recently reported regulatory functions that adipocyte enhancer-binding protein 1 (AEBP1) exerts on PPARgamma1 and LXRalpha transcriptional activity in the context of macrophage cholesterol homeostasis and inflammation.
19179605 ACLP and its discoidin-like domain may be novel targets for anti-myofibroblast-based therapies for the treatment of pulmonary fibrosis.
16307171 Transgenic overexpression of AEBP1 during adipogenesis coupled with a high-fat diet results in massive obesity in female transgenic mice via adipocyte hyperplasia.
11438679 Most ACLP knockout mice die perinatally due to abdominal issues.

AA Sequence

MAAVRGAPLLSCLLALLALCPGGRPQTVLTDDEIEEFLEGFLSELEPEPREDDVEAPPPPEPTPRVRKAQ      1 - 70
AGGKPGKRPGTAAEVPPEKTKDKGKKGKKDKGPKVPKESLEGSPRPPKKGKEKPPKATKKPKEKPPKATK     71 - 140
KPKEKPPKATKKPKEKPPKATKKPPSGKRPPILAPSETLEWPLPPPPSPGPEELPQEGGAPLSNNWQNPG    141 - 210
EETHVEAREHQPEPEEETEQPTLDYNDQIEREDYEDFEYIRRQKQPRPPPSRRRRPERVWPEPPEEKAPA    211 - 280
PAPEERIEPPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPK    281 - 350
EETDKWAVEKGKDHKEPRKGEELEEEWTPTEKVKCPPIGMESHRIEDNQIRASSMLRHGLGAQRGRLNMQ    351 - 420
TGATEDDYYDGAWCAEDDARTQWIEVDTRRTTRFTGVITQGRDSSIHDDFVTTFFVGFSNDSQTWVMYTN    421 - 490
GYEEMTFHGNVDKDTPVLSELPEPVVARFIRIYPLTWNGSLCMRLEVLGCSVAPVYSYYAQNEVVATDDL    491 - 560
DFRHHSYKDMRQLMKVVNEECPTITRTYSLGKSSRGLKIYAMEISDNPGEHELGEPEFRYTAGIHGNEVL    561 - 630
GRELLLLLMQYLCREYRDGNPRVRSLVQDTRIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIFE    631 - 700
DFPDLNSVLWGAEERKWVPYRVPNNNLPIPERYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVS    701 - 770
YPYDMARTPTQEQLLAAAMAAARGEDEDEVSEAQETPDHAIFRWLAISFASAHLTLTEPYRGGCQAQDYT    771 - 840
GGMGIVNGAKWNPRTGTINDFSYLHTNCLELSFYLGCDKFPHESELPREWENNKEALLTFMEQVHRGIKG    841 - 910
VVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNF    911 - 980
ILARSNWKRIREIMAMNGNRPIPHIDPSRPMTPQQRRLQQRRLQHRLRLRAQMRLRRLNATTTLGPHTVP    981 - 1050
PTLPPAPATTLSTTIEPWGLIPPTTAGWEESETETYTEVVTEFGTEVEPEFGTKVEPEFETQLEPEFETQ   1051 - 1120
LEPEFEEEEEEEKEEEIATGQAFPFTTVETYTVNFGDF                                   1121 - 1158
//

Text Mined References (24)

PMID Year Title
24344132 2014 Aortic carboxypeptidase-like protein (ACLP) enhances lung myofibroblast differentiation through transforming growth factor ? receptor-dependent and -independent pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22821744 2012 AEBP1 gene variants in infants with gastroschisis.
22796454 2012 Berberine-induced inhibition of adipocyte enhancer-binding protein 1 attenuates oxidized low-density lipoprotein accumulation and foam cell formation in phorbol 12-myristate 13-acetate-induced macrophages.
22723309 2012 Identification of genomic targets of transcription factor AEBP1 and its role in survival of glioma cells.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20419060 2010 PPARgamma1 and LXRalpha face a new regulator of macrophage cholesterol homeostasis and inflammatory responsiveness, AEBP1.
20396415 2010 Regulation of IkappaBalpha function and NF-kappaB signaling: AEBP1 is a novel proinflammatory mediator in macrophages.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19179605 2009 Aortic carboxypeptidase-like protein is expressed in fibrotic human lung and its absence protects against bleomycin-induced lung fibrosis.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16307171 The role of AEBP1 in sex-specific diet-induced obesity.
15654748 2005 MAPK modulates the DNA binding of adipocyte enhancer-binding protein 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11438679 2001 Impaired abdominal wall development and deficient wound healing in mice lacking aortic carboxypeptidase-like protein.
10510298 1999 Enzymic characterization of a novel member of the regulatory B-like carboxypeptidase with transcriptional repression function: stimulation of enzymic activity by its target DNA.
9624159 1998 Aortic carboxypeptidase-like protein, a novel protein with discoidin and carboxypeptidase-like domains, is up-regulated during vascular smooth muscle cell differentiation.
9099699 1997 Cloning and expression of human carboxypeptidase Z, a novel metallocarboxypeptidase.
8920928 1996 A cDNA cloning of human AEBP1 from primary cultured osteoblasts and its expression in a differentiating osteoblastic cell line.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.