Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.10
PubTator Score 7.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytic glioma -1.300 4.7e-03
atypical teratoid / rhabdoid tumor -1.200 3.0e-03
chronic lymphosyte leukemia 1.200 2.2e-05
colon cancer -3.700 7.1e-11
cystic fibrosis 2.770 2.7e-07
ependymoma -1.300 9.4e-03
gastric carcinoma -1.800 3.5e-02
glioblastoma -1.300 1.7e-03
interstitial cystitis -2.500 1.5e-02
intraductal papillary-mucinous adenoma (... 2.400 3.9e-02
intraductal papillary-mucinous carcinoma... 2.700 3.2e-02
intraductal papillary-mucinous neoplasm ... 3.400 9.8e-03
lung adenocarcinoma -1.100 1.5e-06
lung cancer -1.700 2.2e-02
lung carcinoma -2.800 1.5e-15
medulloblastoma -1.500 5.4e-05
medulloblastoma, large-cell -1.300 3.4e-02
non-small cell lung cancer -2.692 9.9e-20
oligodendroglioma -1.200 5.3e-03
osteosarcoma -2.072 2.6e-04
pancreatic cancer 1.600 6.3e-03
primitive neuroectodermal tumor -1.500 3.9e-03
psoriasis -1.300 1.1e-03
sarcoidosis -1.300 4.6e-03
uncontrolled asthma -1.300 1.0e-02
urothelial carcinoma -1.200 5.3e-05

Gene RIF (9)

AA Sequence

MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRT      1 - 70
KGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLA     71 - 140
EVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLL    141 - 210
GEKLNHWKWGDMRQPRKKRK                                                      211 - 230
//

Text Mined References (16)

PMID Year Title