Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.85
PubTator Score 7.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
urothelial carcinoma -3.500 9.5e-05
astrocytic glioma -1.300 4.7e-03
ependymoma -1.300 9.4e-03
oligodendroglioma -1.200 5.3e-03
uncontrolled asthma -1.300 1.0e-02
psoriasis -1.300 1.1e-03
osteosarcoma -2.072 2.6e-04
chronic lymphosyte leukemia 3.300 1.0e-08
cystic fibrosis 2.770 2.7e-07
atypical teratoid / rhabdoid tumor -1.200 3.0e-03
glioblastoma -1.300 1.7e-03
medulloblastoma -1.500 5.4e-05
medulloblastoma, large-cell -1.300 3.4e-02
primitive neuroectodermal tumor -1.500 3.9e-03
non-small cell lung cancer -2.692 9.9e-20
intraductal papillary-mucinous adenoma (... 2.400 3.9e-02
intraductal papillary-mucinous carcinoma... 2.700 3.2e-02
intraductal papillary-mucinous neoplasm ... 3.400 9.8e-03
lung cancer -1.800 1.7e-03
colon cancer -3.700 7.1e-11
pancreatic cancer 1.600 6.3e-03
interstitial cystitis -2.900 2.6e-05
lung adenocarcinoma -1.100 1.5e-06
sarcoidosis -1.300 4.6e-03
lung carcinoma -2.800 1.5e-15
gastric carcinoma -1.800 3.5e-02

Gene RIF (9)

PMID Text
27018888 These results indicate that AIG1 and ADTRP are founding members of an evolutionarily conserved class of transmembrane threonine hydrolases involved in bioactive lipid metabolism.
26375920 association of ADTRP with the pathogenesis of early-onset CAD
25928384 SNP rs6903956 associated with asymptomatic hyperuricemia susceptibility in Han Chinese
25595457 Activation of PPARG increases the expression of C6ORF105 in human macrophages and atherosclerotic lesions.
24573017 ADTRP polymorphism is associated with the development of coronary atherosclerosis.
23337689 The single nucleotide polymorphism rs6903956 within the ADTRP gene on chromosome 6p24.1 is significantly associated with coronary artery disease in different ethnic groups of the Singaporean population.
21868574 This study confirms ADTRP expression and colocalization with TFPI and caveolin-1 in endothelial cell.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16415175 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRT      1 - 70
KGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLA     71 - 140
EVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLL    141 - 210
GEKLNHWKWGDMRQPRKKRK                                                      211 - 230
//

Text Mined References (16)

PMID Year Title
27018888 2016 AIG1 and ADTRP are atypical integral membrane hydrolases that degrade bioactive FAHFAs.
26375920 2015 Common Variants in Promoter of ADTRP Associate with Early-Onset Coronary Artery Disease in a Southern Han Chinese Population.
25928384 2015 A coronary artery disease-associated SNP rs6903956 contributed to asymptomatic hyperuricemia susceptibility in Han Chinese.
25595457 2015 The coronary artery disease-associated gene C6ORF105 is expressed in human macrophages under the transcriptional control of PPAR?.
24573017 2014 Associations between the CDKN2A/B, ADTRP and PDGFD polymorphisms and the development of coronary atherosclerosis in Japanese patients.
23337689 2013 Association of single nucleotide polymorphism rs6903956 on chromosome 6p24.1 with coronary artery disease and lipid levels in different ethnic groups of the Singaporean population.
21868574 2011 Novel protein ADTRP regulates TFPI expression and function in human endothelial cells in normal conditions and in response to androgen.
21618603 2011 Evidence for gene-environment interaction in a genome wide study of nonsyndromic cleft palate.
21378986 2011 Genome-wide association identifies a susceptibility locus for coronary artery disease in the Chinese Han population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16415175 2006 High throughput SNP and expression analyses of candidate genes for non-syndromic oral clefts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.