Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.41
PubTator Score 2.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy -1.813 4.0e-05
autosomal dominant Emery-Dreifuss muscul... -1.166 5.2e-05
Duchenne muscular dystrophy -1.203 4.0e-08
ependymoma 1.300 3.4e-03
interstitial cystitis -1.200 3.9e-04
medulloblastoma, large-cell -1.700 2.4e-03
nasopharyngeal carcinoma -1.700 3.9e-09
pancreatic ductal adenocarcinoma liver m... -1.569 2.1e-02
pituitary cancer -1.600 4.8e-06
psoriasis -1.200 1.1e-69
spina bifida 2.604 4.2e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MSGTRASNDRPPGAGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADIISRCQGGNNAG      1 - 70
HTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKGLKDWEKRLIISDRAHLVFDF     71 - 140
HQAVDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFSSRFKNLAHQHQSMFPTL    141 - 210
EIDIEGQLKRLKGFAERIRPMVRDGVYFMYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGV    211 - 280
CTGLGIPPQNIGDVYGVVKAYTTRVGIGAFPTEQINEIGGLLQTRGHEWGVTTGRKRRCGWLDLMILRYA    281 - 350
HMVNGFTALALTKLDILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWE    351 - 420
DLPPQAQNYIRFVENHVGVAVKWVGVGKSRESMIQLF                                     421 - 457
//

Text Mined References (10)

PMID Year Title