Property Summary

NCBI Gene PubMed Count 50
PubMed Score 45.58
PubTator Score 166.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.1e-07
diabetes mellitus 1728 1.3e-03

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 1.3e-03
ovarian cancer 2.000 1.1e-07

PDB (13)

Gene RIF (30)

AA Sequence

MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVE      1 - 70
DDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGAS     71 - 140
GSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSR    141 - 210
SQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGP    211 - 280
AGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASG    281 - 350
QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD                 351 - 407
//

Text Mined References (60)

PMID Year Title