Property Summary

NCBI Gene PubMed Count 316
PubMed Score 550.21
PubTator Score 632.85

Knowledge Summary

Patent (13,551)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.200 1.1e-03

Gene RIF (363)

PMID Text
26617941 ADRB3 expression correlated strongly with overactive bladder related symptoms.
26602921 our result suggested complex interactions amongst the studied SNPs and ADRB3 rs4994 as candidate influencing GBC susceptibility.
26410938 Genetic association of ADRB3 single nucleotide polymorphism with metabolic syndrome among the Tatars
25928572 Trp64Arg polymorphism associated with elevated lipid and apolipoprotein levels in Chinese population
25867395 Meta-analysis: Trp64Arg polymorphism in the beta3-AR gene is involved in the pathogenesis of overactive bladder.
25827163 Study tested the association of peroxisome proliferator-activated receptor and beta3-AR polymorphisms with metabolic, nutritional, and blood pressure parameters in 271 postmenopausal women
25800470 W64R Polymorphism in the adrenergic beta-3- receptor is not associated with obesity and waist-to-hip ratio.
25636111 T190C variation of the beta3-AR gene was not associated with increased risk for chronic heart failure
25081806 Carriers of the ADRB3 Arg64 allele had a significantly higher relative body weight and relative body mass index compared with non-carriers.
25059067 The results of these studies suggest that genetic variants of the FTO gene rs9939609 genotype and Trp64Arg ADRB3 contribute to the development of obesity among residents of Moscow and Sverdlovsk Region of Russia.
24972470 in the codominant model Trp/Arg genotype, there was an odds ratio or 1.67 which was increased to 2.56 for the Arg/Arg genotype for association with type 2 diabetes
24905907 No significant differences in lipolysis or lipid oxidation were observed between 64R and 64W allele carriers of ADRB3 at any time during the aerobic load.
24890187 These observations clarify the effects of the studied polymorphisms on glomerular filtration rate and exemplify gene-gene interactions influencing renal function.
24885710 beta1 and beta3-adrenergic receptors were expressed in retinal endothelial cells while beta2-adrenergic receptor was not detectable both at protein and mRNA levels.
24786241 genetic polymorphism determines relationship between childhood obesity and asthma in Taiwan
24741957 Genetic polymorphisms of ADRB3, FTO, and UCP2 genes are associated with overweight in athletes of winter sports.
24670327 Arg64 associated with decreased response to reactive hyperemia in the brachial artery
24658877 Higher levels of cardiorespiratory fitness may attenuate the risk of atherosclerosis associated with ADRB3 Trp64Arg polymorphism.
24579945 Results suggest that epigenetic changes at the ADRB3 gene locus might be involved in the development of obesity and its related metabolic complications.
24556804 ADRb3 T190C polymorphism is significantly associated with Gallbladder cancer and gallstone disease susceptibility.
24460850 study indicates a positive association between periodontal disease and the beta-3 adrenergic receptor genotype in obese individuals.
24378642 results demonstrate that the activation of beta3-adrenoceptors inhibits neurogenic contractions ofboth rat and human urinary bladder.
24201118 Suggest that ADRB3 C190T may be involved in the complex pathophysiology of coronary artery disease.
24190960 Enhanced expression of beta3-adrenoceptors in cardiac myocytes attenuates neurohormone-induced hypertrophic remodeling through nitric oxide synthase.
24138564 UCP1 -3826A/G and ADRB3 Trp64Arg polymorphisms may have a combined effect in the modulation of overweight/obesity and HDL-C levels in type 2 diabetes mellitus (T2DM) Caucasian-Brazilian patients
24038238 This study shows that the Trp64Arg polymorphism in the beta3-AR gene is weakly but significantly associated with overactive bladder syndrome
23968135 The study signifies that the Arg64 allele of the ADRB3 gene is a genotypic risk factor and confers susceptibility to type 2 diabetes
23907236 beta3-ARs are expressed in B16F10 melanoma cells. beta3-ARs are involved in B16F10 cell proliferation and apoptosis. Reduced beta3-AR function decreases the growth of melanoma induced by B16F10 cell inoculation
23736006 Weight loss using mono- and poly-unsaturated low calorie diets was compared for subjects with and without the trp64 polymorphism on the ADRB3 gene. The metabolic effect of weight loss was greater for the normal genotype.
23729572 Trp64Arg polymorphism was associated with hyperuricemia in a Chinese male population and should be an independent risk factor for hyperuricemia
23640967 genetic association studies in population in China: Data suggest that 2 SNPs in ADRB3 (rs72655364, Ser165Pro; rs72655365, Ser257Pro) are associated with type 2 diabetes; 1 SNP in ADRB3 (rs72655365) is associated with insulin resistance.
23454374 High ADRB3 expression is associated with pheochromocytoma.
23388888 these data indicate that B3-AR-induced proliferation depends on the biphasic activation of Erk1/2 sequentially induced by the Gs/PKA/Src and Gi/Src/PI3K signaling pathways.
23360304 Human ureteral relaxation is mediated by both beta(2) - and beta(3) -adrenoceptor stimulation. beta(3) -Adrenoceptor agonists have the potential to relax the human ureter, and their clinical application in the treatment of ureteral stones is expected.
23292548 In a study population of young adult Japanese males, the impact of the Trp64Arg polymorphism on the association between exercise and body composition was weak, if it existed at all.
23282015 A significant relationship between Trp64Arg polymorphism of the ADRB3 gene and a higher frequency of metabolic syndrome was observed in obese children.
23235150 beta(3)-adrenergic stimulation acts through up-regulation of E-selectin in adipose tissue endothelial cells to induce neutrophil infiltration
23113754 study found disease risk factors in postmenopausal women are not directly associated with the polymorphisms of peroxisome proliferator-activated receptor gamma 2 and adrenoceptor beta 3 genes
23032405 beta3AR 64 Trp/Arg substitution accelerates age-related decrease in BAT activity, and thereby may associate with visceral fat accumulation with age.
22972489 Data do not support the hypothesis that polymorphisms in the B3AR gene are associated with alterations of bladder function.
22774474 Trp64Arg genotypes of ADRB3 compared to Trp64Trp genotypes had significantly higher body fat percentage, serum glucose and uric acid concentrations.
22774401 Report interaction of -55CT polymorphism of UCP3 gene with Trp64Arg polymorphism of beta3adrenoreceptor gene on insulin resistance in obese patients.
22743651 Report ADRB3 expression in vascular neoplasms.
22728712 Aromatic residues in adrenergic beta-3 receptor play an important role in the function of the receptor.
22692629 The expression of bladder mucosal beta3-AR mRNA was significantly decreased in patients with severe bladder outlet obstruction, suggesting that beta3-ARs might be affected by the degree of bladder outlet obstruction.
22609474 We obtained no evidence for the association of ADRB3 Trp64Arg with the development of depressive disorder or schizophrenia. However, the Arg allele was found to be associated with higher BMI and being overweight in patients with schizophrenia.
22550477 The level of LDL, age, and ADRB3 polymorphism (Arg/Arg genotype) were statistically associated with annual BMI gain in Japanese men.
22430195 Report efficacy of hbeta3-adrenoceptor agonists as bladder smooth muscle relaxants.
22306453 beta-1 and beta-3 adrenergic receptors were expressed in an orthotopic mouse model of transduced Nalm-6 huma pre-B ALL cells
21992420 The Arg64 allele of the ADRB3 gene in the ethnic Kyrgyz population has an association with metabolic syndrome components such as obesity, abdominal obesity and decreased HDL-C level.
21959333 The present study demonstrated the interaction among beta3AR Trp64Arg, beta2AR Arg16Gly and UCP1 -3826A>G for the accumulation of visceral fat.
21940308 ss3-AR polymorphisms in IBS patients are different compared to controls. ss3-AR polymorphisms could be associated with IBS.
21878665 In human multipotent adipose-derived stem cells differentiated into functional brown adipocytes, activation of either beta(1)-adrenergic receptors or beta(3)-adrenergic receptors was able to increase UCP1 mRNA and protein levels.
21529759 The tryptophan 64 arginine polymorphism in the beta-3 adrenergic receptor was associated with overactive bladder syndrome in Brazilian women.
21358132 Trp64Arg variant of ADRB3 was associated with body mass index in East Asians, but not Europeans
21285172 Results suggest that beta-3-adrenergic receptor (ADRB3) rs4994 polymorphism is a potential candidate for the pathogenesis of gout in a male Chinese population.
21085551 Observational study of gene-disease association. (HuGE Navigator)
21034552 The mutation of beta3-AR gene is the independent risk factor for the prevalence of metabolic syndrome in men.
21034552 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21033077 Observational study of gene-disease association. (HuGE Navigator)
20953633 These data indicate that beta(3)-receptor expression is maintained with age, but may function in concert with other beta-receptors.
20831043 Observational study of gene-disease association. (HuGE Navigator)
20803423 Beta2-adrenergic receptor is the major adrenoceptor that stimulates the UCP1.
20803423 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20735409 brief review of the current evidence whether human heart contains functional beta3-adrenoceptors [REVIEW]
20730725 Observational study of gene-disease association. (HuGE Navigator)
20705341 Observational study of gene-disease association. (HuGE Navigator)
20686326 Investigated if the Trp64Arg polymorphism of ADRB3 is associated with weight changes in obese Japanese men. After 4 years, the participants with the ADRB3 Arg allele increased their body weight & BMI; compared to participants without the Arg allele.
20686326 Observational study of gene-disease association. (HuGE Navigator)
20662153 ADRbeta3 polymorphism association with obesity-related traits in 140 obese patients, was determined.
20662153 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20503258 A non-synonymous ADRB3 rs4994 polymorphism is associated with Type-2 diabetes and Metabolic Syndrome.
20503258 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20467565 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20459474 Observational study of gene-disease association. (HuGE Navigator)
20449541 The finding of this study is the association of the Trp64/Arg64 Beta3AR with higher levels of HOMA. Frequencies of this polymorphism are different among geographic areas
20449541 Observational study of gene-disease association. (HuGE Navigator)
20410100 Observational study of gene-disease association. (HuGE Navigator)
20401689 A non-significant association between total body fat (TBF) and B3Trp64Arg persisted among sedentary controls only when intervention groups were separated (%TBF gain with B3Arg64+ carriage, p = 0.03); exercisers lost TBF regardless of genotype.
20401689 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20203292 ADRB3 was overexpressed in bronchi of cystic fibrosis patients.
20144152 In patients with concentric and eccentric hypertrophy significantly higher frequency of Arg/Arg genotype compared with patients with normal LV geometry and concentric LV remodeling was also noted.
20078877 Observational study of gene-disease association. (HuGE Navigator)
20069060 Tryptophan 64 arginine polymorphism in ADRB3 is associated with reduction of fat oxidation both in resting and aerobic exercise in healthy, young Japanese males.
20069060 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20044737 Meta-analysis of gene-disease association. (HuGE Navigator)
20008926 Trp64Arg polymorphism of the ADRB3 gene predicts hyperuricemia risk in a population from southern Spain.
20008926 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19842096 In cirrhosis of humans and rats, beta(3)-AR expression is markedly increased in hepatic and in splanchnic tissues.
19779464 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19659999 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19587357 Meta-analysis of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19576569 ADRB3 gene has been subjected to a selective sweep in African populations, the Trp64 variant possibly representing the selection target; association of the ancestral ADRB3 Arg64 allele with obesity and type 2 diabetes.
19565482 Adrenergic receptor (alpha(1A)-AR, beta(2)-AR, and beta(3)-AR) gene polymorphisms are related to the risk of developing fibromyalgia (FM) and are also linked to different domains of the FM syndrome.
19565482 Observational study of gene-disease association. (HuGE Navigator)
19553224 Polymorphism of the ADRB3 gene seems to be associated with elite endurance performance
19553224 Observational study of gene-disease association. (HuGE Navigator)
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19367093 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19295193 Clinical trial of gene-disease association. (HuGE Navigator)
19271249 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19193342 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19193342 Four genetic variants, the 102T allele of HTR2A, the 825T allele of GNB3, the 23Cys allele of HTR2C, and the 64Arg/Arg genotype of ADRB3, were significantly associated with olanzapine-induced weight gain.
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19099777 beta3-AR gene Trp64Arg polymorphism and ACE gene I/D polymorphism are related to insulin resistance in small for gestational age infants.
19099777 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19080138 beta(3)-AR gene Trp64Arg mutation is an independent risk factor for the incidence of metabolic syndrome in males.
19080138 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19056576 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19026982 Observational study of genetic testing. (HuGE Navigator)
18996293 Data show that presurgical morbidly obese patients with a mutant beta3 adrenoceptor gene have a poorer inflammatory profile, lipid profile and fat distribution than wild-type group.
18996293 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18940396 presence of the Trp64Arg variant of the beta(3)-adrenergic receptor gene may not play a major role as a hindrance to weight reduction.
18940396 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18852493 Upregulation of beta3-adrenergic receptor mRNA is associated with colon cancer.
18820136 bladder relaxation in man is mediated exclusively via beta(3)-AR.
18753860 Observational study of gene-disease association. (HuGE Navigator)
18724972 Observational study of gene-disease association. (HuGE Navigator)
18704193 beta3-ARs are positively coupled to L-type Ca2+ channels and contractility in human atrial tissues through a cAMP-dependent pathway
18636124 Observational study of gene-disease association. (HuGE Navigator)
18625943 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18617734 The patients of the mutant group (Trp64/Arg64) had higher body mass index, weight, waist circumference, fat mass, waist-to-hip ratio, and C-reactive protein values than those of the wild-type group
18617734 Observational study of gene-disease association. (HuGE Navigator)
18611262 Observational study of gene-disease association. (HuGE Navigator)
18574485 data suggest that the Trp64Arg ADRB3 genetic variant might be associated with BMI in East Asians, but not Europeans.
18574485 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18513389 Observational study of gene-disease association. (HuGE Navigator)
18510051 In healthy pregnant women the relationship between Trp64Arg polymorphism of ADRB3 receptor and body gain has been suggested
18484422 Aberrations in the beta-adrenoceptor signalling systems, rather than in the regulation of expression of these receptors may occur in preeclampsia
18482921 Findings suggested a role of the beta(3)-adrenergic receptor gene polymorphism in regulating lipid and lipoprotein metabolism.
18482921 Observational study of gene-disease association. (HuGE Navigator)
18441513 the genotypes of beta(3)-AR Trp64Arg polymorphism might be not associated with caffeine-induced increases in energy expenditure levels
18441513 Observational study of gene-disease association. (HuGE Navigator)
18426866 Observational study of gene-disease association. (HuGE Navigator)
18422027 Trp64Arg polymorphism of beta3-adrenergic receptor is not associated with obesity
18422027 Observational study of gene-disease association. (HuGE Navigator)
18393130 The presence of the Glu27 polymorphisms of the ADRB2 genes are not directly related to indices of the metabolic syndrome in blach South African women.
18393130 Observational study of gene-disease association. (HuGE Navigator)
18335327 Trp64Arg polymorphism of the beta(3)-adrenergic receptor gene is not related to metabolic syndrome in postmenopausal Polish women but seems to be associated with decreased high density lipoprotein-cholesterol levels
18335327 Observational study of gene-disease association. (HuGE Navigator)
18331634 Observational study of gene-disease association. (HuGE Navigator)
18311486 These results confirm the presence of beta1-, beta2-, and beta3-adrenoceptors in human urinary bladder urothelium; they suggest that urothelial beta-adrenoceptors induce the release of a urothelium-derived factor muscle
18273796 There was no significant difference in the genotype frequency of the beta3-AR p.W64R and the LEP c.-2548G>A polymorphisms, between lean and obese subjects.
18273796 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18249219 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18249022 The Trp64Arg polymorphism of beta3-adrenergic receptor was not associated with obesity. However, the Arg-allele was associated with a slightly increased risk of type 2 diabetes
18249022 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18239290 Observational study of gene-disease association. (HuGE Navigator)
18088254 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18088254 Our study in combination with a meta-analysis of previous reports do not provide support for a role of missense mutation replacing tryptophan with arginine at codon 64 (Trp64Arg) at the human ADRB3 gene in CHD risk.
18054709 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17999941 beta3-AR are upregulated during sepsis in the human myocardium and by cytokines in murine cardiomyocytes, where they mediate an increased negative inotropic response to beta3 agonists.
17998022 Observational study of gene-disease association. (HuGE Navigator)
17998022 Polymorphism of the beta-3 adrenergic receptor plays a role in the genetic predisposition to increased small dense low-density lipoprotein.
17989355 ADRB3 adrenergic receptor is a key regulator of human myometrial apoptosis and inflammation during chorioamnionitis.
17940985 Observational study of gene-disease association. (HuGE Navigator)
17910280 These data show that the presence of the Arg64 allele at the beta3-adenoceptor gene locus is related to increase in leptin level in this population, but is not related to body mass index.
17910280 Observational study of gene-disease association. (HuGE Navigator)
17852419 Observational study of gene-disease association. (HuGE Navigator)
17852419 Trp64Arg polymorphism of (beta3-adrenergic receptor) ADRB3 is related to obesity in postmenopausal and has no influence on oxidative stress intensification after standardized physical effort.
17786291 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17785925 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17727676 Joint association of allele -75A (APOA1) and allele Arg64 (ADRB3) increase the risk of DM2 in a population from southern Spain.
17727676 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17640319 Observational study of gene-disease association. (HuGE Navigator)
17640319 The ADRB3 Trp64Arg polymorphism is associated with gallstone disease.
17631141 demonstration of expression of beta(3)-AR in the enteric nervous system
17626108 Observational study of gene-disease association. (HuGE Navigator)
17626108 the arginine 64 allele of the beta(3)-adrenergic receptor gene does not increase the risk of obstructive sleep apnoea syndrome, but is associated with the development of obesity in those patients who suffer obstructive sleep apnoea syndrome
17624182 Observational study of gene-disease association. (HuGE Navigator)
17624182 Polymorphisms within the Beta-3 Adrenergic Receptor gene are associated with insulin resistance and obesity.
17616777 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17591269 Observational study of gene-disease association. (HuGE Navigator)
17512307 Observational study of gene-disease association. (HuGE Navigator)
17476189 Observational study of gene-disease association. (HuGE Navigator)
17476189 Results describe the effects of polymorphisms in the genes encoding microsome triglycerides transfer protein (MTP) and beta3-adrenergic receptor (beta3-AR) on lipid and glucose metabolism.
17445027 Observational study of gene-disease association. (HuGE Navigator)
17445027 The Trp64Arg variation in the beta-3 adrenergic receptor has no relationship to the degree or incidence of childhood obesity.
17439327 Observational study of gene-disease association. (HuGE Navigator)
17439327 beta3-AR Trp64Arg and beta2-AR Gln27Glu genetic polymorphisms are associated with obesity in Chinese male hypertensive patients
17378367 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17378367 The findings demonstrate that the Arg64 allele of the beta3-adrenoceptor polymorphisms relates to weight gain-induced BP elevation accompanying high plasma norepinephrine in obese men.
17345789 Observational study of gene-disease association. (HuGE Navigator)
17345789 no relationship between ADRB3 polymorphism and metabolic syndrome in Shiga, Japan
17345787 Observational study of gene-disease association. (HuGE Navigator)
17342473 Observational study of gene-disease association. (HuGE Navigator)
17299491 Observational study of gene-disease association. (HuGE Navigator)
17299491 ADRB3 polymorphism was significantly related to insulin resistance only in male subjects; moreover, increased BMI was related to age in obese subjects with the ADRB3 polymorphism.
17299381 Observational study of gene-disease association. (HuGE Navigator)
17270896 Observational study of gene-disease association. (HuGE Navigator)
17264845 Observational study of gene-disease association. (HuGE Navigator)
17264845 The wild-type allele of the ADRB3 missense change was associated with measures of obesity in our sample of African-American women
17225053 Trp64Arg polymorphism of the beta-3 adrenergic receptor may be independently associated with hyperuricemia in males.
17225053 Observational study of gene-disease association. (HuGE Navigator)
17190106 Observational study of gene-disease association. (HuGE Navigator)
17124363 Observational study of gene-disease association. (HuGE Navigator)
17124363 ADRB3 gene polymorphisms do not associate with obesity.
17087055 Observational study of gene-disease association. (HuGE Navigator)
17046546 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16820065 Observational study of gene-disease association. (HuGE Navigator)
16779985 Observational study of gene-disease association. (HuGE Navigator)
16715838 Observational study of gene-disease association. (HuGE Navigator)
16715838 Finds that the Trp64Arg polymorphism in the beta3-AR gene does not represent an independent risk factor for coronary artery disease in Arabs but may be used as a predictor of coronary artery disease when other risk factors are present.
16648810 Observational study of gene-disease association. (HuGE Navigator)
16493638 Observational study of gene-disease association. (HuGE Navigator)
16493638 The ADRB3 gene does not seem to exert an important role in excessive fat accumulation in Brazilians of European descent.
16449022 Observational study of gene-disease association. (HuGE Navigator)
16444766 A variant in ADRB3 influences diabetes risk in an Mexican American family and supports a role for alterations of the beta3-adrenergic receptor in the pathogenesis of type 2 diabetes.
16408483 Observational study of gene-disease association. (HuGE Navigator)
16369102 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16320158 Observational study of gene-disease association. (HuGE Navigator)
16320158 results suggest no association between Trp64Arg polymorphism of the beta3-AR gene and the incidence of overweight and type 2 diabetes mellitus in Polish population
16301818 beta3 adrenoceptor activation exerts inhibitory effect on human fibroblast DNA synthesis as a result of the activation of nitric oxide-cyclic GMP pathway and the inhibition of adenylate cyclase activity.
16286518 Meta-analysis of gene-disease association. (HuGE Navigator)
16276029 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16054001 Observational study of gene-disease association. (HuGE Navigator)
16027735 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16009000 Observational study of gene-disease association. (HuGE Navigator)
15959859 Observational study of gene-disease association. (HuGE Navigator)
15956122 Observational study of gene-disease association. (HuGE Navigator)
15956122 beta3-adrenergic receptor Trp64Arg polymorphism is linked to BP elevation
15942638 Observational study of gene-disease association. (HuGE Navigator)
15939803 Observational study of gene-disease association. (HuGE Navigator)
15932670 Beta(3)-adrenoceptor mRNA expressions were significantly higher in patients with heart failure than those in controls.
15917856 Observational study of gene-disease association. (HuGE Navigator)
15915764 Observational study of gene-disease association. (HuGE Navigator)
15833937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15833937 evidence for an interaction between the beta1- and beta2-adrenergic receptors was observed in men for longitudinal change in body mass index and women showed suggestive evidence for an interaction between
15824464 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15824464 Both newly detected TSC C1784T and ADRB3 T727C are gene polymorphisms susceptible to the antihypertensive effect of thiazides in patients with essential hypertension
15751274 Observational study of gene-disease association. (HuGE Navigator)
15743038 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15743038 the Arg allele of the Trp64Arg polymorphism in the beta3-adrenergic receptor gene may contribute to the susceptibility to endometrial cancer among obese/overweight individuals
15670186 Observational study of gene-disease association. (HuGE Navigator)
15641247 study does not confirm the influence of Trp64Arg mutation in heterozygous carriers on insulin resistance
15613846 Observational study of gene-environment interaction. (HuGE Navigator)
15585565 predominant role for beta(3)-AR in the regulation of human myometrium contractility, especially at the end of pregnancy
15563584 beta3-adrenoceptor (beta3-AR) stimulation regulates the activity of cystic fibrosis transmembrane conductance regulator (CFTR) chloride channel.
15543217 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15536594 Observational study of gene-disease association. (HuGE Navigator)
15536594 The beta(3)-AR Trp64Arg polymorphism might have an impact on the mechanisms involved in leptin release from adipose tissue.
15489932 Observational study of gene-disease association. (HuGE Navigator)
15479221 Observational study of gene-disease association. (HuGE Navigator)
15472194 Observational study of gene-disease association. (HuGE Navigator)
15472194 the Trp64Arg beta3-AR gene polymorphism may contribute to insulin resistance associated with reduced fetal growth.
15464701 Observational study of gene-disease association. (HuGE Navigator)
15355441 Polymorphisms in beta3-adrenergic receptor is associated with Type 2 Diabetes Mellitus
15340101 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15340101 results suggest that the combination of cholecystokinin 1 receptor (CCK1R) and the beta3-adrenergic receptor (beta3-AR) polymorphisms is a contributing factor for midlife weight gain in men
15334382 Observational study of gene-disease association. (HuGE Navigator)
15334382 the ADRB2 Arg(16)-Gly genotype influences total cholesterol and LDL-C levels in an age-specific manner, that it may interact with beta(3)-adrenergic receptor Trp(64)-Arg genotypes
15334374 Observational study of gene-disease association. (HuGE Navigator)
15334374 the ADRB3 Trp64Arg variant is not related to the development of gestational diabetes mellitus and has no effect on obesity during pregnancy in a Taiwanese population
15318095 Observational study of gene-disease association. (HuGE Navigator)
15302798 Beta3-adrenoceptors are expressed in the endothelium of human coronary resistance arteries and mediate adrenergic vasodilatation through both NO and vessel hyperpolarization.
15193960 Observational study of genotype prevalence. (HuGE Navigator)
15192823 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15179018 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15166301 Observational study of gene-disease association. (HuGE Navigator)
15166301 body fat response to exercise training in older adults is associated with the combined effects of the Glu12/Glu9 alpha2b-adrenergic receptor, Trp64Arg beta3-adrenergic receptor, and Gln27Glu beta2-adrenergic receptor gene variants
15123695 hetero-oligomerization between beta(2)AR and beta(3)AR forms a beta-adrenergic signaling unit that possesses unique functional properties
15079793 Observational study of gene-disease association. (HuGE Navigator)
15061987 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15042014 Observational study of gene-disease association. (HuGE Navigator)
15042014 The Trp64Arg polymorphism of the beta(3)-receptor does not predispose to preeclampsia, and it is it not associated with obesity and carbohydrate intolerance in a population of young pregnant women.
14747257 polymorphic in metabolic syndrome phenotype in brazil
14742851 Observational study of gene-disease association. (HuGE Navigator)
14742851 beta(3) adrenergic receptor (ADRB3) R64 allele was associated with increased body weight and body mass index in men but not in women
14739355 Observational study of gene-disease association. (HuGE Navigator)
14739355 the Trp64Arg variant of the beta3-adrenergic receptor gene may have a role in the central adiposity gain in a metabolic syndrome
14715679 Observational study of gene-disease association. (HuGE Navigator)
14715679 beta3-AR genotype does not appear to be associated with any maximal or submaximal exercise CV hemodynamic responses in postmenopausal women.
14713387 Observational study of gene-disease association. (HuGE Navigator)
14713387 altitude-related lifestyle of a population has had little influence on the frequency of Trp64Arg polymorphism and obesity in Bolivian natives
14708035 Observational study of gene-gene interaction and gene-environment interaction. (HuGE Navigator)
14690019 Observational study of gene-disease association. (HuGE Navigator)
14671190 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14671190 The Trp(64)Arg mutation of ADRB3 has little or no influence on either body weight or body mass index in the general Japanese population.
14510956 Observational study of gene-disease association. (HuGE Navigator)
14506613 Observational study of gene-disease association. (HuGE Navigator)
14506613 genotypes of aldehyde dehydrogenase 2 and beta3-adrenergic receptor were strongly associated with elevated alanine aminotransferase level which increased with the accumulation of components of metabolic syndrome
12962933 Observational study of gene-disease association. (HuGE Navigator)
12962933 ADRB3 polymorphism is not associated with a risk of endometrial neoplasms.
12917707 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12824951 b3-AR 64Arg polymorphisms have a protective effect against metabolic disorders in obese families from southern Poland.
12739037 Observational study of gene-disease association. (HuGE Navigator)
12739037 Arg64/arg64 beta(3)-AR polymorphism may contribute to increased triglycerides and very low-density lipoprotein cholesterol in rheumatoid arthritis patients, independently of chloroquine treatment.
12739018 Observational study of genotype prevalence, gene-disease association, and gene-gene interaction. (HuGE Navigator)
12739018 Amino acid substistution is not associated with insulin resistance phenotype.
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12709137 Observational study of gene-disease association. (HuGE Navigator)
12690078 Observational study of gene-disease association. (HuGE Navigator)
12690078 results suggest that the Arginine-64 beta(3)-adrenoceptor allele contributes significantly to the genetic variability in both resting metabolic rate and thermic effect of feeding
12670949 beta3-adrenergic receptors play a role in proliferation and migration of cultured human retinal endothelial cells.
12647276 Observational study of gene-disease association. (HuGE Navigator)
12647276 findings suggest that the Trp64Arg variant in the beta3-adrenergic receptor gene may be associated with reducing LDL particle size, probably due to insulin resistance
12629568 Observational study of gene-disease association. (HuGE Navigator)
12568179 Observational study of gene-disease association. (HuGE Navigator)
12561621 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12544508 Observational study of gene-environment interaction. (HuGE Navigator)
12453902 Observational study of gene-disease association. (HuGE Navigator)
12442007 Observational study of gene-disease association. (HuGE Navigator)
12411100 Observational study of gene-disease association. (HuGE Navigator)
12410955 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12406043 Observational study of gene-disease association. (HuGE Navigator)
12370850 genetic variants in the gene appear not to have a major role as modifier genes in familial combined hyperlipidemia
12241539 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12169859 Observational study of gene-disease association. (HuGE Navigator)
12164325 Observational study of genotype prevalence. (HuGE Navigator)
12133431 Observational study of gene-disease association. (HuGE Navigator)
12133431 The frequency of Trp64Arg mutation of beta(3)-AR gene was higher in the male subjects with MS than those with simple obesity and non-obese controls
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12062855 polymorphism found to be associated with exercise-mediated improvement in glucose tolerance and leptin resistance in healthy Japanese men
12037740 Observational study of gene-disease association. (HuGE Navigator)
12037740 obese postmenopausal women who carry the Trp64Arg variant in the beta(3)-adrenoceptor had similar changes in body composition and energy expenditure to noncarriers of the variant in response to prolonged caloric restriction
12008746 Observational study of gene-disease association. (HuGE Navigator)
11984699 Observational study of gene-disease association. (HuGE Navigator)
11949887 the cAMP response of W64R-beta3AR can be enhanced under the particular condition that adenylyl cyclase type III was coexpressed
11882399 Observational study of gene-disease association. (HuGE Navigator)
11875710 lipid mobilizing factor induces lipolysis through binding to a beta3-adrenoceptor
11872697 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11854867 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11808891 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11798745 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11769635 Observational study of gene-disease association. (HuGE Navigator)
11743057 Meta-analysis of gene-disease association. (HuGE Navigator)
11743056 Observational study of gene-disease association. (HuGE Navigator)
11716317 Observational study of genetic testing. (HuGE Navigator)
11706779 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11699048 Observational study of gene-disease association. (HuGE Navigator)
11592045 Observational study of gene-disease association. (HuGE Navigator)
11576322 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11573151 Observational study of gene-disease association. (HuGE Navigator)
11532330 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11522702 Observational study of gene-disease association. (HuGE Navigator)
11466580 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11439286 Observational study of gene-disease association. (HuGE Navigator)
11434877 Observational study of gene-disease association. (HuGE Navigator)
11380082 Observational study of gene-disease association. (HuGE Navigator)
11315829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11288809 Observational study of gene-disease association. (HuGE Navigator)
11287026 Observational study of gene-disease association. (HuGE Navigator)
11244458 Observational study of gene-disease association. (HuGE Navigator)
11229427 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11213599 Observational study of gene-disease association. (HuGE Navigator)
11206402 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11147800 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11095426 Observational study of gene-environment interaction. (HuGE Navigator)
11093283 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
10999801 Observational study of gene-disease association. (HuGE Navigator)
10805511 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MAPWPHENSSLAPWPDLPTLAPNTANTSGLPGVPWEAALAGALLALAVLATVGGNLLVIVAIAWTPRLQT      1 - 70
MTNVFVTSLAAADLVMGLLVVPPAATLALTGHWPLGATGCELWTSVDVLCVTASIETLCALAVDRYLAVT     71 - 140
NPLRYGALVTKRCARTAVVLVWVVSAAVSFAPIMSQWWRVGADAEAQRCHSNPRCCAFASNMPYVLLSSS    141 - 210
VSFYLPLLVMLFVYARVFVVATRQLRLLRGELGRFPPEESPPAPSRSLAPAPVGTCAPPEGVPACGRRPA    211 - 280
RLLPLREHRALCTLGLIMGTFTLCWLPFFLANVLRALGGPSLVPGPAFLALNWLGYANSAFNPLIYCRSP    281 - 350
DFRSAFRRLLCRCGRRLPPEPCAAARPALFPSGVPAARSSPAQPRLCQRLDGASWGVS                351 - 408
//

Text Mined References (317)

PMID Year Title
26617941 2015 Beta-3 adrenergic receptors could be significant factors for overactive bladder-related symptoms.
26602921 2015 A Multiple Interaction Analysis Reveals ADRB3 as a Potential Candidate for Gallbladder Cancer Predisposition via a Complex Interaction with Other Candidate Gene Variations.
26410938 2015 [Genetic Association of ADRA2A and ADRB3 Genes with Metabolic Syndrome among the Tatars].
25928572 2015 Effect of the beta-3 adrenergic receptor Trp64Arg and uncoupling protein 1-3826 A>G genotypes on lipid and apolipoprotein levels in overweight/obese and non-obese Chinese subjects.
25867395 2015 Association between polymorphism of ?3-adrenoceptor gene and overactive bladder: a meta-analysis.
25827163 2015 Association of PPAR-?2 and ?3-AR Polymorphisms With Postmenopausal Hypertension.
25800470 2015 ?-3AR W64R Polymorphism and 30-Minute Post-Challenge Plasma Glucose Levels in Obese Children.
25636111 2015 [Association of T190C polymorphism of ?3 adrenergic receptor gene with response to carvedilol in patients with chronic heart failure].
25081806 Effects of energy expenditure gene polymorphisms on obesity-related traits in obese children.
25059067 2014 [Regional features of obesity-associated gene polymorphism (rs9939609 FTO gene and gene Trp64Arg ADRB3) in Russian population].
24972470 2014 Association of ?1 and ?3 adrenergic receptors gene polymorphisms with insulin resistance and high lipid profiles related to type 2 diabetes and metabolic syndrome.
24905907 2014 Carnitine palmitoyltransferase 1B 531K allele carriers sustain a higher respiratory quotient after aerobic exercise, but ?3-adrenoceptor 64R allele does not affect lipolysis: a human model.
24890187 2014 Additive effect of polymorphisms in the ?2 -adrenoceptor and NADPH oxidase p22 phox genes contributes to the loss of estimated glomerular filtration rate in Chinese.
24885710 2014 Differential expression and role of hyperglycemia induced oxidative stress in epigenetic regulation of ?1, ?2 and ?3-adrenergic receptors in retinal endothelial cells.
24786241 2014 ?3-Adrenergic receptor gene modifies the association between childhood obesity and asthma.
24741957 2013 [Identification of genetic polymorphisms associated with overweight in athletes of winter sports].
24670327 2015 The Trp64Arg ?3-adrenergic receptor gene polymorphism is associated with endothelium-dependent vasodilatation.
24658877 2014 Higher cardiorespiratory fitness attenuates the risk of atherosclerosis associated with ADRB3 Trp64Arg polymorphism.
24579945 2014 ADRB3 gene promoter DNA methylation in blood and visceral adipose tissue is associated with metabolic disturbances in men.
24556804 2014 Association of adrenergic receptor gene polymorphisms in gallbladder cancer susceptibility in a North Indian population.
24460850 2014 The interaction between beta-3 adrenergic receptor polymorphism and obesity to periodontal disease in community-dwelling elderly Japanese.
24378642 2014 Modulation of nerve-evoked contractions by ?3-adrenoceptor agonism in human and rat isolated urinary bladder.
24201118 2014 Significant role of ADRB3 rs4994 towards the development of coronary artery disease.
24190960 2014 Enhanced expression of ?3-adrenoceptors in cardiac myocytes attenuates neurohormone-induced hypertrophic remodeling through nitric oxide synthase.
24138564 2014 The presence of at least three alleles of the ADRB3 Trp64Arg (C/T) and UCP1 -3826A/G polymorphisms is associated with protection to overweight/obesity and with higher high-density lipoprotein cholesterol levels in Caucasian-Brazilian patients with type 2 diabetes.
24038238 2014 Association between polymorphism of beta3-adrenoceptor gene and overactive bladder.
23968135 2013 Trp homozygotes at codon 64 of ADRB3 gene are protected against the risk of type 2 diabetes in the Kashmiri population.
23907236 2013 Functional involvement of ?3-adrenergic receptors in melanoma growth and vascularization.
23736006 2013 Genetic variation in the beta 3-adrenoreceptor gene (Trp64Arg polymorphism) and its influence on anthropometric parameters and insulin resistance under a high monounsaturated versus a high polyunsaturated fat hypocaloric diet.
23729572 2013 Trp64Arg (rs4994) polymorphism of ?3-adrenergic receptor gene is associated with hyperuricemia in a Chinese male population.
23640967 2013 Two novel functional single nucleotide polymorphisms of ADRB3 are associated with type 2 diabetes in the Chinese population.
23454374 2013 White-to-brown transdifferentiation of omental adipocytes in patients affected by pheochromocytoma.
23388888 2013 Biphasic Erk1/2 activation sequentially involving Gs and Gi signaling is required in beta3-adrenergic receptor-induced primary smooth muscle cell proliferation.
23360304 2013 Expression and functional role of ?3 -adrenoceptors in the human ureter.
23292548 2013 Beta-3-adrenergic receptor Trp64Arg polymorphism: does it modulate the relationship between exercise and percentage of body fat in young adult Japanese males?
23282015 2013 Visceral fat accumulation and metabolic syndrome in children: the impact of Trp64Arg polymorphism of the beta3-adrenergic receptor gene.
23235150 2013 ?3-Adrenergic receptor stimulation induces E-selectin-mediated adipose tissue inflammation.
23113754 2013 ADRB3 and PPAR?2 gene polymorphisms and their association with cardiovascular disease risk in postmenopausal women.
23032405 2013 Impact of UCP1 and ?3AR gene polymorphisms on age-related changes in brown adipose tissue and adiposity in humans.
22972489 2013 Are polymorphisms of the ?(3)-adrenoceptor gene associated with an altered bladder function?
22774474 2012 [The Trp64Arg polymorphism of beta3-adrenoreceptor gene study in persons with overweight and obesity].
22774401 2012 Interaction of -55CT polymorphism of UCP3 gene with Trp64Arg polymorphism of beta3adrenoreceptor gene on insulin resistance in obese patients.
22743651 2012 ?-Adrenergic receptor expression in vascular tumors.
22728712 2012 The essential role for aromatic cluster in the ?3 adrenergic receptor.
22692629 2013 Relationship between expression of ?3-adrenoceptor mRNA in bladder mucosa and urodynamic findings in men with lower urinary tract symptoms.
22609474 2012 Possible impact of ADRB3 Trp64Arg polymorphism on BMI in patients with schizophrenia.
22550477 2012 ADRB3 polymorphism associated with BMI gain in Japanese men.
22430195 2012 An aryloxypropanolamine h?3-adrenoceptor agonist as bladder smooth muscle relaxant.
22306453 2012 Chronic stress enhances progression of acute lymphoblastic leukemia via ?-adrenergic signaling.
21992420 2011 An association between TRP64ARG polymorphism of the B3 adrenoreceptor gene and some metabolic disturbances.
21982743 2011 The arrestin domain-containing 3 protein regulates body mass and energy expenditure.
21959333 2011 Association between accumulation of visceral fat and the combination of ?3 adrenergic receptor Trp64Arg, ?2 adrenergic receptor Arg16Gly and uncoupling protein 1 -3826A>G polymorphisms detected by Smart Amplification Process 2.
21940308 A genetic association between ß3-aderenoceptor and cholinergic receptor muscarinic 3 polymorphisms in irritable bowel syndrome.
21878665 2011 ??-Adrenergic receptors increase UCP1 in human MADS brown adipocytes and rescue cold-acclimated ??-adrenergic receptor-knockout mice via nonshivering thermogenesis.
21529759 2011 The relationship between the Trp 64 Arg polymorphism of the beta 3-adrenoceptor gene and idiopathic overactive bladder.
21358132 2011 [Association of BMI with the beta3 adrenergic receptor gene mutation: a meta-analysis].
21285172 2011 Positive correlation between Beta-3-Adrenergic Receptor (ADRB3) gene and gout in a Chinese male population.
21085551 2010 A positive association between homeostasis model assessment of insulin resistance score and the Trp64Arg polymorphism of the ?3-Adrenergic receptor gene in schizophrenia patients in Taiwan.
21034552 2010 Relationship between Trp64Arg mutation in the ?3-adrenergic receptor gene and metabolic syndrome: a seven-year follow-up study.
21033077 2010 [Correlation of metabolic syndrome clinical signs and genetic determinants at children with obese].
20953633 2010 ?-Adrenergic receptor subtype expression in myocyte and non-myocyte cells in human female bladder.
20831043 2010 [Genetic predisposition to development of atrial fibrillation in patients with hypertensive disease].
20803423 2010 The effects of uncoupling protein 1 and beta3-adrenergic receptor gene polymorphisms on weight loss and lipid profiles in obese women.
20735409 2011 Are there functional ??-adrenoceptors in the human heart?
20730725 2010 Distribution of the Trp64Arg polymorphism in the ß 3-adrenergic receptor gene in athletes and its influence on cardiovascular function.
20705341 2010 Association between genetic polymorphisms of adrenergic receptor and diurnal intraocular pressure in Japanese normal-tension glaucoma.
20686326 2010 The Trp64Arg polymorphism of the beta3-adrenergic receptor gene is associated with weight changes in obese Japanese men: a 4-year follow-up study.
20662153 2010 Beta3-adrenergic receptor polymorphism is related to cardiometabolic risk factors in obese Brazilian subjects.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20503258 2010 Candidate gene association study conditioning on individual ancestry in patients with type 2 diabetes and metabolic syndrome from Mexico City.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20467565 2010 The relationship between birthweight and longitudinal changes of blood pressure is modulated by beta-adrenergic receptor genes: the Bogalusa Heart Study.
20459474 2011 Can we predict top-level sports performance in power vs endurance events? A genetic approach.
20449541 Polymorphism Trp64Arg of beta 3 adrenoreceptor gene: allelic frequencies and influence on insulin resistance in a multicenter study of Castilla-León.
20410100 2010 Genetic variation in APOJ, LPL, and TNFRSF10B affects plasma fatty acid distribution in Alaskan Eskimos.
20401689 2010 Lifestyle modifies the relationship between body composition and adrenergic receptor genetic polymorphisms, ADRB2, ADRB3 and ADRA2B: a secondary analysis of a randomized controlled trial of physical activity among postmenopausal women.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20203292 2011 ?1, ?2, and ?3 adrenoceptors and Na+/H+ exchanger regulatory factor 1 expression in human bronchi and their modifications in cystic fibrosis.
20144152 2010 [Myocardial hypertrophy in patients with hypertensive disease: the role of genetic polymorphism of beta-adrenoreactive structures].
20078877 2010 Gene polymorphisms in association with emerging cardiovascular risk markers in adult women.
20069060 2009 Trp64Arg polymorphism in beta3-adrenergic receptor gene is associated with decreased fat oxidation both in resting and aerobic exercise in the Japanese male.
20044737 2010 Synopsis and data synthesis of genetic association studies in hypertension for the adrenergic receptor family genes: the CUMAGAS-HYPERT database.
20008926 2010 Trp64Arg polymorphism of the ADRB3 gene predicts hyperuricemia risk in a population from southern Spain.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19842096 2009 Role of beta3-adrenoceptors for intrahepatic resistance and portal hypertension in liver cirrhosis.
19779464 2009 Genetic factors are relevant and independent determinants of antihypertensive drug effects in a multiracial population.
19659999 2009 Effects of UCP2 -866 G/A and ADRB3 Trp64Arg on rosiglitazone response in Chinese patients with Type 2 diabetes.
19587357 2009 A systematic meta-analysis of genetic association studies for diabetic retinopathy.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19576569 2009 Diverse evolutionary histories for beta-adrenoreceptor genes in humans.
19565482 2009 Association of adrenergic receptor gene polymorphisms with different fibromyalgia syndrome domains.
19553224 2011 Trp64Arg polymorphism in ADRB3 gene is associated with elite endurance performance.
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19367093 2009 Association study between candidate genes and obesity-related phenotypes using a sample of lumberjacks.
19295193 2009 Influence of Trp64Arg polymorphism of beta 3-adrenoreceptor gene on insulin resistance, adipocytokines and weight loss secondary to two hypocaloric diets.
19271249 2009 Extended tracts of homozygosity identify novel candidate genes associated with late-onset Alzheimer's disease.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19193342 2008 Multiple genetic factors in olanzapine-induced weight gain in schizophrenia patients: a cohort study.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19099777 2008 [Influence of angiotensin converting enzyme gene insertion/deletion polymorphism and beta3-adrenergic receptor gene Trp64Arg polymorphism on fetal growth and neonatal insulin sensitivity].
19080138 2008 [A prospective study of the relationship between Trp64Arg beta(3)-adrenergic receptor gene polymorphism and metabolic syndrome].
19056576 2009 Effects of novel capsinoid treatment on fatness and energy metabolism in humans: possible pharmacogenetic implications.
19026982 2009 High-throughput chemiluminometric genotyping of single nucleotide polymorphisms of histamine, serotonin, and adrenergic receptor genes.
18996293 2008 Relation of Trp64Arg polymorphism of beta3-adrenoreceptor gene with cardiovascular risk factors in presurgical morbidly obese patients.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18940396 2008 No effect of the Trp64Arg variant of the beta3-adrenergic receptor gene on weight loss by diet and exercise intervention among Japanese adults.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18852493 2008 Upregulation of beta3-adrenergic receptor mRNA in human colon cancer: a preliminary study.
18820136 2009 Catecholamines relax detrusor through beta 2-adrenoceptors in mouse and beta 3-adrenoceptors in man.
18753860 2008 Genetic polymorphisms differently influencing the emergence of atrophy and fat accumulation in HIV-related lipodystrophy.
18724972 2008 Sex differences in environmental and genetic factors for hypertension.
18704193 2008 beta3-adrenergic receptor activation increases human atrial tissue contractility and stimulates the L-type Ca2+ current.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18625943 2008 Intraocular pressure response to topical beta-blockers associated with an ADRB2 single-nucleotide polymorphism.
18617734 2008 Relation of Trp64Arg polymorphism of beta 3-adrenergic receptor gene to adipocytokines and fat distribution in obese patients.
18611262 2008 Genetic variation in candidate obesity genes ADRB2, ADRB3, GHRL, HSD11B1, IRS1, IRS2, and SHC1 and risk for breast cancer in the Cancer Prevention Study II.
18574485 2008 The ADRB3 Trp64Arg variant and BMI: a meta-analysis of 44 833 individuals.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18510051 2008 [The significance of beta-3 adrenergic receptor polymorphism in excessive body gain and obesity development in pregnant women].
18484422 2008 Beta-adrenoceptor subtype expression in human placenta and umbilical arteries in normal and preeclamptic pregnancies.
18482921 2008 Polymorphism of Trp64Arg in beta3-adrenergic receptor gene and serum LDL-cholesterol concentrations in healthy Japanese.
18441513 2008 Lack of association of the Trp64Arg polymorphism of beta3-adrenergic receptor gene with energy expenditure in response to caffeine among young healthy women.
18426866 2008 Association of FTO with obesity-related traits in the Cebu Longitudinal Health and Nutrition Survey (CLHNS) Cohort.
18422027 2008 Association of Trp64Arg polymorphism of beta3-adrenergic receptor with insulin resistance in Polish children with obesity.
18393130 2008 Genetic polymorphisms of beta2- and beta3-adrenergic receptor genes associated with characteristics of the metabolic syndrome in black South African women.
18335327 2008 beta(3)-adrenergic receptor polymorphism and metabolic syndrome in postmenopausal women.
18331634 2008 Adrenergic gene polymorphisms and cardiovascular risk in the NHLBI-sponsored Women's Ischemia Syndrome Evaluation.
18311486 2008 Expression and functional role of beta-adrenoceptors in the human urinary bladder urothelium.
18273796 2007 LEPR p.Q223R, beta3-AR p.W64R and LEP c.-2548G>A gene variants in obese Brazilian subjects.
18249219 2008 Interaction of single nucleotide polymorphisms in ADRB2, ADRB3, TNF, IL6, IGF1R, LIPC, LEPR, and GHRL with physical activity on the risk of type 2 diabetes mellitus and changes in characteristics of the metabolic syndrome: The Finnish Diabetes Prevention Study.
18249022 2008 Association of the beta3-adrenergic receptor Trp64Arg polymorphism with common metabolic traits: studies of 7605 middle-aged white people.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18239290 2008 Adrenergic beta1 receptor polymorphism (Ser49Gly) is associated with obesity in type II diabetic patients.
18088254 2008 T64A polymorphism in beta3-adrenergic receptor gene (ADRB3) and coronary heart disease: a case-cohort study and meta-analysis.
18054709 2007 Influence of the Trp64Arg polymorphism in the beta 3 adrenoreceptor gene on insulin resistance, adipocytokine response, and weight loss secondary to lifestyle modification in obese patients.
17999941 2007 Sepsis is associated with an upregulation of functional beta3 adrenoceptors in the myocardium.
17998022 2007 The Trp64Arg polymorphism of the beta3-adrenergic receptor gene is associated with increased small dense low-density lipoprotein in a rural Japanese population: the Mima study.
17989355 2008 ADRB3 adrenergic receptor is a key regulator of human myometrial apoptosis and inflammation during chorioamnionitis.
17940985 [Relationship of beta(3)-adrenergic receptor polymorphism with metabolic syndrome and oxidative stress parameters in postmenopausal women].
17910280 2007 Association of body mass index and Trp64Arg polymorphism of the beta3-adrenoreceptor gene and leptin level in Tehran Lipid and Glucose Study.
17852419 2007 Post-exercise oxidative stress and obesity in postmenopausal women: the role of beta3-adrenergic receptor polymorphism.
17786291 2007 Association of gene polymorphisms with myocardial infarction in individuals with different lipid profiles.
17785925 2007 Common single nucleotide polymorphisms in Japanese patients with essential hypertension: aldehyde dehydrogenase 2 gene as a risk factor independent of alcohol consumption.
17727676 2008 Effect of the combination of the variants -75G/A APOA1 and Trp64Arg ADRB3 on the risk of type 2 diabetes (DM2).
17640319 2007 Arg64 variant of the beta3-adrenergic receptor is associated with gallstone formation.
17631141 2007 Demonstration of functional neuronal beta3-adrenoceptors within the enteric nervous system.
17626108 2007 beta3-Adrenergic receptor Trp64Arg polymorphism and increased body mass index in sleep apnoea.
17624182 2007 Association of beta3 adrenergic receptor and peroxisome proliferator-activated receptor gamma 2 polymorphisms with insulin sensitivity: a twin study.
17616777 2007 Variants of the peroxisome proliferator-activated receptor gamma- and beta-adrenergic receptor genes are associated with measures of compensatory eating behaviors in young children.
17591269 2007 [Association of beta-adrenoceptor gene polymorphism with resting heart rate].
17512307 2007 Association analyses of adrenergic receptor polymorphisms with obesity and metabolic alterations.
17476189 2007 Postprandial plasma lipid levels are influenced by the interaction of functional polymorphisms in the microsome triglyceride transfer protein and beta3 adrenergic receptor genes.
17445027 2007 Variation analysis of beta3-adrenergic receptor and melanocortin-4 receptor genes in childhood obesity.
17439327 2007 The genetic polymorphisms of beta3-adrenergic receptor (AR) Trp64Arg and beta2-AR Gln27Glu are associated with obesity in Chinese male hypertensive patients.
17378367 2006 beta2- and beta3-Adrenoceptor polymorphisms relate to subsequent weight gain and blood pressure elevation in obese normotensive individuals.
17345789 2006 Relationship between metabolic syndrome and Trp64arg polymorphism of the beta-adrenergic receptor gene in a general sample: the Shigaraki study.
17345787 2006 Genetic influences of beta-adrenoceptor polymorphisms on arterial functional changes and cardiac remodeling in hypertensive patients.
17342473 2007 A variant in the transcription factor 7-like 2 (TCF7L2) gene is associated with an increased risk of gestational diabetes mellitus.
17299491 2007 Metabolic syndrome and ADRB3 gene polymorphism in severely obese patients from South Italy.
17299381 2007 Contribution of several candidate gene polymorphisms in the determination of adiposity changes: results from the Québec Family Study.
17270896 2004 Association of beta-adrenoceptor single nucleotide polymorphisms with resting heart rate.
17264845 2007 The ADRB3 Trp64Arg variant and obesity in African-American breast cancer cases.
17225053 2007 The association between hyperuricemia and the Trp64Arg polymorphism of the beta-3 adrenergic receptor.
17190106 2006 Impact of aging and beta3-adrenergic-receptor polymorphism on thermic and sympathetic responses to a high-fat meal.
17124363 2007 LEPR, ADBR3, IRS-1 and 5-HTT genes polymorphisms do not associate with obesity.
17087055 2006 Comparison of body fat distribution and blood lipid profiles according to Trp64Arg polymorphism for the beta 3-adrenergic receptor gene in Korean middle-aged women.
17046546 2006 Polymorphisms of insulin receptor substrate 1 and beta3-adrenergic receptor genes in gestational diabetes and normal pregnancy.
16820065 2006 Beta3-adrenergic receptor gene, body mass index, bone mineral density and fracture risk in elderly men and women: the Dubbo Osteoporosis Epidemiology Study (DOES).
16779985 2006 Association of polymorphisms in the beta2 and beta3 adrenoceptor gene with polycystic ovary syndrome.
16715838 2005 Beta 3 adrenergic receptor Trp64Arg polymorphism and manifestation of coronary artery disease in Arabs.
16648810 Association study of six activity SNPS in adrenal steroid hormone metabolism and IBM related genes with precocious puberty in Chinese girls.
16493638 Impact of variation in ADRB2, ADRB3, and GNB3 genes on body mass index and waist circumference in a Brazilian population.
16449022 2006 Genetic factors and clinical significance of acanthosis nigricans in obese Japanese children and adolescents.
16444766 A novel missense mutation in ADRB3 increases risk for type 2 diabetes in a Mexican American family.
16408483 2005 Change of components of the metabolic syndrome in a workers' health checkup after five years--relation with elevated liver enzymes, gene polymorphisms for ALDH 2, beta3-AR and lifestyle.
16369102 2006 Genetic and environmental factors associated with the development of hypertension in pregnancy.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16320158 2005 The Trp64Arg beta3-adrenergic receptor amino-acid variant is not associated with overweight and type 2 diabetes mellitus in Polish population.
16301818 2005 Activation of beta3 adrenergic receptor decreases DNA synthesis in human skin fibroblasts via cyclic GMP/nitric oxide pathway.
16286518 2005 Meta-analysis of the association of the Trp64Arg polymorphism in the beta3 adrenergic receptor with insulin resistance.
16276029 2005 Increased risk of obesity resulting from the interaction between high energy intake and the Trp64Arg polymorphism of the beta3-adrenergic receptor gene in healthy Japanese men.
16054001 2005 Beta2-adrenoceptor polymorphisms relate to insulin resistance and sympathetic overactivity as early markers of metabolic disease in nonobese, normotensive individuals.
16027735 2005 beta-Blockade and increased dyslipidemia in patients bearing Glu27 variant of beta2 adrenergic receptor gene.
16009000 2005 [Polymorphisms in the beta2 and beta3 adrenergic receptor genes in obstructive sleep apnea/hypopnea syndrome].
15959859 2005 Single nucleotide variants in the beta2-adrenergic and beta3-adrenergic receptor genes explained 18.3% of adolescent obesity variation.
15956122 2005 Beta2- and beta3-adrenergic receptor polymorphisms are related to the onset of weight gain and blood pressure elevation over 5 years.
15942638 2005 The frequency of Trp64Arg polymorphism of the beta3-adrenergic receptor gene in healthy and obese Hungarian children and its association with cardiovascular risk factors.
15939803 2005 Lys418Asn polymorphism of the alpha2-adrenoceptor gene relates to serum uric acid levels but not to insulin sensitivity.
15932670 2005 [The relationship between expressions of beta1-, beta2-, beta3-adrenoceptor mRNA of myocardium and cardiac function in patients with heart failure].
15917856 2005 Association between beta-adrenergic receptor polymorphisms and their G-protein-coupled receptors with body mass index and obesity in women: a report from the NHLBI-sponsored WISE study.
15915764 2005 [Relationship between of carotid ultrasonography in Japanese hypertensive subjects for intima-media thickness and plaque, and candidate gene polymorphism--possibility of early detection of arteriosclerotic disease].
15833937 2005 Interactive effects between polymorphisms in the beta-adrenergic receptors and longitudinal changes in obesity.
15824464 2004 The thiazide-sensitive Na(+)-Cl(-) cotransporter gene, C1784T, and adrenergic receptor-beta3 gene, T727C, may be gene polymorphisms susceptible to the antihypertensive effect of thiazide diuretics.
15751274 2005 No association of the Trp 64 Arg mutation of the beta3-adrenergic receptor gene with obesity, type 2 diabetes mellitus, hyperlipidemia, and hypertension in Japanese patients with schizophrenia.
15743038 2004 An association between the Trp64Arg polymorphism in the beta3-adrenergic receptor gene and endometrial cancer and obesity.
15670186 2005 Tryptophan 64 --> arginine polymorphism of beta-3-adrenergic receptor in Chilean women with polycystic ovary syndrome.
15641247 1999 [Mutation in the beta3-adrenergic receptor gene (Trp64Arg) does not influence insulin resistence, energy metabolism, fat distribution and lipid spectrum in young people. Pilot study].
15613846 2004 [The effects of aerobic exercise on hormones, blood lipids and body composition in middle-aged obese women according to beta 3-adrenergic receptor gene polymorphisms].
15585565 2005 Beta3-adrenoceptor is the predominant beta-adrenoceptor subtype in human myometrium and its expression is up-regulated in pregnancy.
15563584 2005 Transfected beta3- but not beta2-adrenergic receptors regulate cystic fibrosis transmembrane conductance regulator activity via a new pathway involving the mitogen-activated protein kinases extracellular signal-regulated kinases.
15543217 2004 Gene-gene interaction between PPAR gamma 2 and ADR beta 3 increases obesity risk in children and adolescents.
15536594 2004 The Arg64 allele of the beta 3-adrenoceptor gene but not the -3826G allele of the uncoupling protein 1 gene is associated with increased leptin levels in the Spanish population.
15489932 2004 [A twin study of association of beta3AR Trp64Arg polymorphisms with insulin sensitivity].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479221 2004 Variants in the human beta 1-, beta 2-, and beta 3-adrenergic receptor genes are not associated with morbid obesity in children and adolescents.
15472194 2004 Effects of the Trp64Arg polymorphism in the beta3-adrenergic receptor gene on insulin sensitivity in small for gestational age neonates.
15464701 2004 Association of beta-adrenergic receptor polymorphisms and progression to heart failure in patients with idiopathic dilated cardiomyopathy.
15355441 2004 Common variants in beta2- and beta3-adrenergic receptor genes and uncoupling protein 1 as predictors of the risk for type 2 diabetes and body weight changes. The Finnish Diabetes Prevention Study.
15340101 2004 Association of cholecystokinin 1 receptor and beta3-adrenergic receptor polymorphisms with midlife weight gain.
15334382 2004 The beta(2)-adrenergic receptor Arg16-gly polymorphism and interactions involving beta(2)- and beta(3)-adrenergic receptor polymorphisms are associated with variations in longitudinal serum lipid profiles: the Bogalusa Heart Study.
15334374 2004 Lack of relationship between beta3-adrenergic receptor gene polymorphism and gestational diabetes mellitus in a Taiwanese population.
15318095 2004 Polymorphisms of interleukin-1 beta and beta 3-adrenergic receptor in Japanese patients with nonalcoholic steatohepatitis.
15302798 2004 Endothelial beta3-adrenoceptors mediate vasorelaxation of human coronary microarteries through nitric oxide and endothelium-dependent hyperpolarization.
15193960 2004 Ethnic differences of coronary artery disease-associated SNPs in two Israeli healthy populations using MALDI-TOF mass spectrometry.
15192823 2004 [Additive effects of the variants in the beta(3)-adrenergic receptor and uncoupling protein-2 genes on obesity in Chinese].
15179018 2004 Association study of adrenergic beta3 receptor (Trp64Arg) and G-protein beta3 subunit gene (C825T) polymorphisms and weight change during clozapine treatment.
15166301 2004 Association between body fat response to exercise training and multilocus ADR genotypes.
15123695 2004 Hetero-oligomerization between beta2- and beta3-adrenergic receptors generates a beta-adrenergic signaling unit with distinct functional properties.
15079793 2004 [The genotype analysis of beta adrenergic receptor gene family in high risk population of hypertension in northeast China].
15061987 2004 [Common variants in beta 3-adrenergic-receptor and uncoupling protein-2 genes are associated with type 2 diabetes and obesity].
15042014 2004 The Trp64Arg polymorphism of the beta3-adrenergic receptor is not increased in women with preeclampsia.
14747257 2004 Influence of the polymorphisms Tpr64Arg in the beta 3-adrenergic receptor gene and Pro12Ala in the PPAR gamma 2 gene on metabolic syndrome-related phenotypes in an indigenous population of the Brazilian Amazon.
14742851 2004 beta(3) Adrenergic receptor polymorphism and obesity-related phenotypes in hypertensive patients.
14739355 2004 Clinical features of the metabolic syndrome in adolescents: minor role of the Trp64Arg beta3-adrenergic receptor gene variant.
14715679 2004 Beta2- and beta3-adrenergic receptor polymorphisms and exercise hemodynamics in postmenopausal women.
14713387 2004 Polymorphism of Trp64Arg in beta3-adrenergic receptor gene among Bolivian people in rural areas at high and low altitudes.
14708035 2004 Additive effect of the mutations in the beta3-adrenoceptor gene and UCP3 gene promoter on body fat distribution and glycemic control after weight reduction in overweight subjects with CAD or metabolic syndrome.
14690019 2003 Relationship between the beta3-adrenoceptor gene variant and body fat in Japanese children.
14671190 2003 The Trp(64)Arg polymorphism of the beta(3)-adrenergic receptor gene is not associated with body weight or body mass index in Japanese: a longitudinal analysis.
14510956 2003 Beta-adrenergic receptor polymorphisms in patients with elevated factor VIII levels with venous thrombosis.
14506613 2003 Aldehyde dehydrogenase 2 and beta3-adrenergic receptor gene polymorphisms: their association with elevated liver enzymes and metabolic syndrome.
12962933 2003 Association of estrogen receptor alpha and beta3-adrenergic receptor polymorphisms with endometrial cancer.
12917707 2003 Difficulty in losing weight by behavioral intervention for women with Trp64Arg polymorphism of the beta3-adrenergic receptor gene.
12824951 2003 An analysis of the link between polymorphisms of the beta2 and beta3 adrenergic receptor gene and metabolic parameters among Polish Caucasians with familial obesity.
12739037 2003 Polymorphism of the beta3-adrenergic receptor and lipid profile in patients with rheumatoid arthritis and systemic lupus erythematosus treated with chloroquine.
12739018 2003 No interactions between polymorphisms in the beta3-adrenergic receptor gene and the PPAR-gamma gene on the risk of the insulin resistance syndrome in the Danish MONICA cohort.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12709137 2003 Effect of Trp64Arg mutation of the beta3-adrenergic receptor gene and C161T substitution of the peroxisome proliferator activated receptor gamma gene on obesity in Japanese children.
12690078 2003 Arg64 beta3-adrenoceptor variant and the components of energy expenditure.
12670949 2003 Beta 3-adrenergic receptors regulate retinal endothelial cell migration and proliferation.
12647276 2003 The polymorphism of the beta3-adrenergic receptor gene is associated with reduced low-density lipoprotein particle size.
12629568 2003 Interactions among the beta2- and beta3- adrenergic receptor genes and total body fat and abdominal fat level in the HERITAGE Family Study.
12568179 2002 Pilot study examining the frequency of several gene polymorphisms in a morbidly obese population.
12561621 2001 [Mutation of beta 3-adrenergic-receptor gene and the response to dietary intervention in obese children].
12544508 2003 A microarray minisequencing system for pharmacogenetic profiling of antihypertensive drug response.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453902 2002 Combined effects of genetic and environmental factors on insulin resistance associated with reduced fetal growth.
12442007 2002 Molecular analysis of adrenergic receptor genes and interleukin-4/interleukin-4 receptor genes in patients with interstitial cystitis.
12411100 2002 Association of GYS1 and beta(3)-AR gene with postprandial hyperglycemia and serum uric acid in type 2 diabetes mellitus.
12410955 2002 A study on the relationship between genetic and environmental factors of type 2 diabetes mellitus in humans.
12406043 2002 TRP64ARG polymorphism of the beta 3-adrenergic receptor gene and obesity risk: effect modification by a sedentary lifestyle.
12370850 2002 Common variants in the lipoprotein lipase gene, but not those in the insulin receptor substrate-1, the beta3-adrenergic receptor, and the intestinal fatty acid binding protein-2 genes, influence the lipid phenotypic expression in familial combined hyperlipidemia.
12241539 2002 The Trp64Arg beta3-adrenergic receptor amino acid variant confers increased sensitivity to the pressor effects of noradrenaline in Sardinian subjects.
12169859 2002 The risk of obesity and the Trp64Arg polymorphism of the beta(3)-adrenergic receptor: effect modification by age.
12164325 2002 Genotype frequencies of 50 polymorphisms for 241 Japanese non-cancer patients.
12133431 2002 [Investigation and comparison of the beta(3)-adrenergic receptor gene Trp64Arg mutation in simple obesity and metabolic syndrome].
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12062855 2002 Prediction of exercise-mediated changes in metabolic markers by gene polymorphism.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
12008746 2002 Impact of polymorphisms of human beta-adrenergic receptor gene on changes in height during growth hormone treatment.
11984699 2002 Association of gene polymorphisms and bone density in Japanese girls.
11949887 2002 Enhanced cAMP response of naturally occurring mutant of human beta3-adrenergic receptor.
11882399 2002 No evidence for an association between genetic polymorphisms of beta(2)- and beta(3)-adrenergic receptor genes with body mass index in Aymara natives from Chile.
11872697 2002 Association between a novel variant of the human type 2 deiodinase gene Thr92Ala and insulin resistance: evidence of interaction with the Trp64Arg variant of the beta-3-adrenergic receptor.
11854867 2002 A polymorphism in the beta1 adrenergic receptor is associated with resting heart rate.
11808891 2001 Association of a mutation in the beta3-adrenergic receptor gene with obesity and response to dietary intervention in Chinese children.
11798745 2000 [Investigation and comparison of the beta3-adrenergic receptor gene Trp64Arg mutation in the Chinese and Japanese].
11769635 2001 [Association of beta 3-adrenergic receptor gene with obesity in patients with type 2 diabetes mellitus].
11743057 2001 Association of BMI with the beta3-adrenergic receptor gene polymorphism in Japanese: meta-analysis.
11743056 2001 Genetic variation and obesity in Australian women: a prospective study.
11716317 2001 Does genetic testing for obesity influence confidence in the ability to lose weight? A pilot investigation.
11706779 2001 Association of polymorphisms in the beta-2 and beta-3 adrenoceptor genes with risk of colorectal cancer in Japanese.
11699048 2001 Effects of intestinal fatty acid-binding protein gene Ala54Thr polymorphism and beta3-adrenergic receptor gene Trp64Arg polymorphism on insulin resistance and fasting plasma glucose in young to older Japanese men.
11592045 2001 [The role of beta3-adrenergic receptor Trp/Arg mutation in childhood obesity].
11576322 2001 Gender specific associations of the Trp64Arg mutation in the beta3-adrenergic receptor gene with obesity-related phenotypes in a Mediterranean population: interaction with a common lipoprotein lipase gene variation.
11573151 2001 Clinical features of a polymorphism of the beta3-adrenergic receptor gene in patients with type 2 diabetes mellitus--a study using a pin-point sequencing method.
11532330 2001 Beta(3)-adrenergic receptor gene variant is associated with upper body obesity only in obese Japanese-American men but not in women.
11522702 2001 Genotype Arg/Arg, but not Trp/Arg, of the Trp64Arg polymorphism of the beta(3)-adrenergic receptor is associated with type 2 diabetes and obesity in a large Japanese sample.
11466580 2001 Association between polymorphisms in candidate genes and morbid obesity.
11439286 2001 Synergistic effect of polymorphisms of uncoupling protein 1 and beta3-adrenergic receptor genes on autonomic nervous system activity.
11434877 2001 Possible association of beta2- and beta3-adrenergic receptor gene polymorphisms with susceptibility to breast cancer.
11380082 2001 Common variants in the beta2-(Gln27Glu) and beta3-(Trp64Arg)--adrenoceptor genes are associated with elevated serum NEFA concentrations and type II diabetes.
11315829 2001 Interactions between variants in the beta3-adrenergic receptor and peroxisome proliferator-activated receptor-gamma2 genes and obesity.
11288809 2001 Relationship of the Trp64Arg polymorphism of the beta3-adrenoceptor gene to central adiposity and high blood pressure: interaction with age. Cross-sectional and longitudinal findings of the Olivetti Prospective Heart Study.
11287026 2001 Candidate gene analysis in premature pubarche and adolescent hyperandrogenism.
11244458 2001 The beta 3-adrenergic receptor gene and obesity in a population sample of African Americans.
11229427 2001 The beta3-adrenergic receptor Trp64Arg mutation is not associated with coronary artery disease.
11213599 2001 Beta 3-adrenergic receptor gene polymorphism and type 2 diabetes in a Caucasian population.
11206402 2001 Genetic and environmental nature of the insulin resistance syndrome in Indo-Mauritian subjects with premature coronary heart disease: contribution of beta3-adrenoreceptor gene polymorphism and beta blockers on triglyceride and HDL concentrations.
11147800 2001 Identification of an interactive effect of beta3- and alpha2b-adrenoceptor gene polymorphisms on fat mass in Caucasian women.
11095426 2000 Insulin response to glucose is lower in individuals homozygous for the Arg 64 variant of the beta-3-adrenergic receptor.
11093283 2000 Frequency of and interaction between polymorphisms in the beta3-adrenergic receptor and in uncoupling proteins 1 and 2 and obesity in Germans.
11013230 2000 Direct binding of activated c-Src to the beta 3-adrenergic receptor is required for MAP kinase activation.
10999801 2000 Studies of the synergistic effect of the Trp/Arg64 polymorphism of the beta3-adrenergic receptor gene and the -3826 A-->G variant of the uncoupling protein-1 gene on features of obesity and insulin resistance in a population-based sample of 379 young Danish subjects.
10805511 2000 Synergistic effect of polymorphisms in uncoupling protein 1 and beta3-adrenergic receptor genes on long-term body weight change in Finnish type 2 diabetic and non-diabetic control subjects.
10786926 2000 Mutated human beta3-adrenergic receptor (Trp64Arg) lowers the response to beta3-adrenergic agonists in transfected 3T3-L1 preadipocytes.
10391210 1999 Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis.
9892244 1999 Polymorphism of the human beta3-adrenoceptor gene forms a well-conserved haplotype that is associated with moderate obesity and altered receptor function.
9126344 1997 Association of a genetic variation in the beta 3-adrenergic receptor gene with coronary heart disease among Japanese.
8721782 1996 Association of Trp64Arg mutation of the beta3-adrenergic-receptor with NIDDM and body weight gain.
8641219 1996 Pharmacological characterization of a recently described human beta 3-adrenergic receptor mutant.
8389717 1993 Molecular cloning of a human beta 3-adrenergic receptor cDNA.
8389293 1993 The promoter and intron/exon structure of the human and mouse beta 3-adrenergic-receptor genes.
8380813 1993 Tissue distribution of beta 3-adrenergic receptor mRNA in man.
8288218 1993 Identification, chromosomal location, and genome organization of mammalian G-protein-coupled receptors.
8011597 1994 The complex of human Gs protein with the beta 3 adrenergic receptor: a computer-aided molecular modeling study.
7898940 1995 Characterization of the region of the short arm of chromosome 8 amplified in breast carcinoma.
7609752 1995 Genetic variation in the beta 3-adrenergic receptor and an increased capacity to gain weight in patients with morbid obesity.
7609625 1995 Evidence for the presence of beta 3-adrenergic receptor mRNA in the human brain.
7565630 1995 Determination of structural domains for G protein coupling and ligand binding in beta 3-adrenergic receptor.
2570461 1989 Molecular characterization of the human beta 3-adrenergic receptor.
1718744 1991 Molecular characterization of the mouse beta 3-adrenergic receptor: relationship with the atypical receptor of adipocytes.
1336117 1992 Rodent and human beta 3-adrenergic receptor genes contain an intron within the protein-coding block.