Property Summary

NCBI Gene PubMed Count 89
PubMed Score 92.85
PubTator Score 118.40

Knowledge Summary

Patent (4,176)

TINX Plot

  Disease (4)

Disease Target Count
Cardiomegaly 66
Fibrosis 40
Heart failure 80
Disease Target Count Z-score Confidence
Gilles de la Tourette syndrome 47 3.305 1.7
Pain agnosia 99 3.213 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 2.300 8.1e-07
astrocytoma -1.100 2.4e-02
glioblastoma -1.400 1.8e-05
primitive neuroectodermal tumor -1.100 4.1e-04
lung cancer 2.200 1.3e-05
breast carcinoma -1.100 2.5e-03
fibroadenoma -1.100 2.2e-02
pediatric high grade glioma -1.300 2.2e-05
non primary Sjogren syndrome sicca 1.100 1.2e-02
lung adenocarcinoma -2.100 2.4e-07
ovarian cancer 1.300 1.3e-05
psoriasis -1.500 1.6e-38

 CSPA Cell Line (3)

Gene RIF (80)

PMID Text
26427149 Common polymorphisms in the ADRA2C gene are not associated with orthostatic hypotension risk in Chinese.
26058836 ADRA2c is associated with heart rate recovery after exercise.
25406899 Adrenergic receptor genotype influences heart failure severity and beta-blocker response in children with dilated cardiomyopathy.
25110951 alpha2C-adrenoreceptor interaction with filamin-2
24676565 the ADRA2C 322-325I/D genotype is a novel genetic risk marker for SBI among individuals with hyperhomocysteinemia.
24643471 Genetic variants of ADRA2C do not alter intracellular localization or plasma membrane trafficking.
23868076 the region comprising the N-terminal half of The receptors contributed to the alpha2C-selectivity of drug binding.
23275278 Bucindolol prevents ventricular arrhythmias in subjects with heart failure and reduced left ventricular ejection fractions, and this effect is modulated by adrenergic alpha 2 receptor polymorphisms.
22560155 The ADRA2A and ADRA2C polymorphisms did not contribute to an increased risk of ischemic stroke or any pathophysiological subtype
22503931 the predicted signal peptide in the N-terminal tail of the alpha(2C)-adrenoceptor does not act as a cleavable signal peptide
22040172 there is little evidence for an association between alpha(2C)Del322-325 polymorphism and an increased prevalence of left ventricular hypertrophy in patients with systemic hypertension.
21298476 alpha1b and alpha2c AR is over-expressed in basal-like breast tumours of poor prognosis
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20705341 Observational study of gene-disease association. (HuGE Navigator)
20692245 Observational study of gene-disease association. (HuGE Navigator)
20613626 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20128806 The alpha(2C)-Del322-325 polymorphism does not exhibit reduced signalling to adenylyl cyclase and may not represent a clinically important phenotype.
19880803 the norepinephrine lowering and clinical therapeutic responses to bucindolol were strongly influenced by alpha(2C) receptor genotype
19880803 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19742303 Observational study of gene-disease association. (HuGE Navigator)
19477404 Observational study of gene-disease association. (HuGE Navigator)
19444546 The ADRA2C del322-325 variant did not affect vascular sensitivity to local cold exposure.
19423370 The common ADRA2C variant affected pain perception before and after dexmedetomidine but did not affect other cognitive responses
19423370 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19352218 Observational study of gene-disease association. (HuGE Navigator)
19309415 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19167638 Genotype polymorphism frequencies for B1 receptor (amino acid positions 389 and 49) and alpha 2c receptor (deletion 322-325) are not significantly different in SC patients compared to female controls.
18947427 Three polymorphisms in ADRA2C and five polymorphisms in ADRB1 were involved in eight cross-validated epistatic interactions identifying several two-locus genotype classes with significant relative risks of death/transplant in heart failure patients
18947427 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18835330 Our findings provide important evidence that the ADRA2C polymorphism is involved in the etiology of ADHD in Korean subjects.
18835330 Observational study of gene-disease association. (HuGE Navigator)
18794726 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18776959 Beta1- and alpha2c-adrenoreceptor variants as predictors of clinical aspects of dilated cardiomyopathy in people of African ancestry.
18776959 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18702968 Genotype and haplotype of ADRA2C did not significantly affect survival in metoprolol-treated or carvedilol-treated heart failure patients.
18698227 Genetic variants in the alpha2C-adrenoceptor and G-protein contribute to ethnic differences in cardiovascular stress responses
18698227 Observational study of gene-disease association. (HuGE Navigator)
18511740 Observational study of gene-disease association. (HuGE Navigator)
18487435 Cyclic AMP acts through Rap1 and JNK signaling to increase expression of cutaneous smooth muscle alpha2C-adrenoceptors.
18435421 Because the alpha(2C)-adrenoceptor distribution pattern is conserved between rodents and humans, studies on the role of the alpha(2C)-adrenoceptor in rodent models of neuropsychiatric disorders may be relevant also for human diseases.
18320080 Homozygosity for the alpha 2C Del322-325 polymorphism is not associated with heart failure in black South Africans
18320080 Observational study of gene-disease association. (HuGE Navigator)
18308161 Observational study of gene-disease association. (HuGE Navigator)
18075481 Polymorphisms are not associated with Toureett's syndrome in this study.
18071056 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17971028 Observational study of gene-disease association. (HuGE Navigator)
17655760 Observational study of gene-disease association. (HuGE Navigator)
17644575 An estrogen-dependent increase in expression of cold-sensitive alpha(2C)-ARs may contribute to the increased activity of cold-induced vasoconstriction under estrogen-replete conditions
17496726 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17383306 Observational study of gene-disease association. (HuGE Navigator)
17351367 Observational study of gene-disease association. (HuGE Navigator)
17351367 The ADRA2C deletion polymorphism had no effect on markers of resting sympathetic activity and cardiovascular measures, and did not account for ethnic differences in blood pressure.
17223428 Observational study of gene-disease association. (HuGE Navigator)
17192578 alpha(2)-ARs might contribute neurotrophic actions in vivo synergistically or in permutation with other neurotrophic factors
17075692 Observational study of gene-disease association. (HuGE Navigator)
16636200 Observational study of gene-disease association. (HuGE Navigator)
16605244 Thus, the alpha(2C)AR alters alpha(2A)AR signaling by forming oligomers, and these complexes, which appear to be preferred over the homodimers, should be considered a functional signaling unit in cells in which both subtypes are expressed.
16569551 Genetic variations of the alpha and beta adrenergic receptors (alpha 2C Del322-325 allele) were found to be significant predictors of vasospastic angina
16464220 Observational study of gene-disease association. (HuGE Navigator)
16407897 Observational study of gene-disease association. (HuGE Navigator)
16407897 A genetic variant of the alpha 2C-adrenoceptor subtype--resulting from the deletion of four consecutive amino acids at codons 322-325--confers a change in brain function playing a role in the pathogenesis of major depressive disorder.
16299019 Observational study of gene-disease association. (HuGE Navigator)
16187973 Observational study of gene-disease association. (HuGE Navigator)
15946904 Observational study of gene-disease association. (HuGE Navigator)
15920038 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15861038 Observational study of gene-disease association. (HuGE Navigator)
15861038 alpha2CDel322-325 polymorphism is associated with increased sympathetic nervous and adrenomedullary hormonal activities, both during supine rest and during pharmacologically evoked catecholamine release
15719258 Observational study of gene-disease association. (HuGE Navigator)
15683753 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15592690 Observational study of genotype prevalence. (HuGE Navigator)
15592690 ADRA2C had one haplotype block of 10 kb
15542284 Observational study of gene-disease association. (HuGE Navigator)
15345481 Increased expression of alpha(2C)-adrenoceptors may contribute to enhanced cold-induced vasoconstriction and Raynaud's phenomenon.
12946937 Alpha2-ARs in vascular smooth muscle cells reflect differential activity of alpha2-AR gene promoters. Alpha2C-ARs can be induced via p38 MAPK-dependent pathway.
12374873 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12210281 Observational study of gene-disease association. (HuGE Navigator)
11317218 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGFLIVFTVVGNV      1 - 70
LVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFGQVWCGVYLALDVLFCTSSIV     71 - 140
HLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISAVISFPPLVSLYRQPDGAAYPQCGLNDETWY    141 - 210
ILSSCIGSFFAPCLIMGLVYARIYRVAKLRTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPP    211 - 280
ADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASS    281 - 350
RSVEFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK    351 - 420
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ                                421 - 462
//

Text Mined References (89)

PMID Year Title
26427149 2015 Association between Common Genetic Variants of ?2A-, ?2B-, and ?2C-Adrenergic Receptors and Orthostatic Hypotension.
26058836 2015 Genetic variation in alpha2-adrenoreceptors and heart rate recovery after exercise.
25406899 2015 Adrenergic receptor genotype influences heart failure severity and ?-blocker response in children with dilated cardiomyopathy.
25110951 2014 In silico modeling of human ?2C-adrenoreceptor interaction with filamin-2.
24676565 2014 Association between common genetic variants of ?2A-, ?2B- and ?2C-adrenoceptors and the risk of silent brain infarction.
24643471 2014 Common ?2A and ?2C adrenergic receptor polymorphisms do not affect plasma membrane trafficking.
23868076 2013 The C-terminal half of the ?2C-adrenoceptor determines the receptor's membrane expression level and drug selectivity.
23275278 2013 Adrenergic receptor polymorphisms and prevention of ventricular arrhythmias with bucindolol in patients with chronic heart failure.
22560155 2013 Association between common genetic variants of ?2A-, ?2B-, and ?2C-adrenergic receptors and ischemic stroke.
22503931 2012 The predicted N-terminal signal sequence of the human ??C-adrenoceptor does not act as a functional cleavable signal peptide.
22040172 2012 The ?(2C)-Del322-325 adrenoceptor polymorphism and the occurrence of left ventricular hypertrophy in hypertensives.
21298476 2011 Alpha- and beta-adrenergic receptor (AR) protein expression is associated with poor clinical outcome in breast cancer: an immunohistochemical study.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20705341 2010 Association between genetic polymorphisms of adrenergic receptor and diurnal intraocular pressure in Japanese normal-tension glaucoma.
20692245 2010 Insertion/insertion genotype of ?(2B)-adrenergic receptor gene polymorphism is associated with silent myocardial ischemia in patients with type 2 diabetes mellitus.
20613626 2010 Resting sympathetic nerve activity is related to age, sex and arterial pressure but not to ?2-adrenergic receptor subtype.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20128806 2010 Lack of effect of the alpha2C-adrenoceptor Del322-325 polymorphism on inhibition of cyclic AMP production in HEK293 cells.
19880803 2010 An alpha2C-adrenergic receptor polymorphism alters the norepinephrine-lowering effects and therapeutic response of the beta-blocker bucindolol in chronic heart failure.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19742303 2009 Genetic ancestry, social classification, and racial inequalities in blood pressure in Southeastern Puerto Rico.
19477404 2009 Polymorphisms of adrenoceptors are not associated with an increased risk of adverse event in heart failure: a MERIT-HF substudy.
19477270 2009 Interaction of the ubiquitin carboxyl terminal esterase L1 with alpha(2)-adrenergic receptors inhibits agonist-mediated p44/42 MAP kinase activation.
19444546 2009 The alpha2C-adrenoceptor deletion322-325 variant and cold-induced vasoconstriction.
19423370 2010 Effects of variation in the human alpha2A- and alpha2C-adrenoceptor genes on cognitive tasks and pain perception.
19352218 2009 Candidate gene analysis in an on-going genome-wide association study of attention-deficit hyperactivity disorder: suggestive association signals in ADRA1A.
19309415 2009 Pharmacogenetics of low dose clonidine in irritable bowel syndrome.
19167638 2009 Adrenergic receptor polymorphisms in patients with stress (tako-tsubo) cardiomyopathy.
18947427 2008 Multiple interactions between the alpha 2C- and beta1-adrenergic receptors influence heart failure survival.
18835330 2008 Association between the alpha-2C-adrenergic receptor gene and attention deficit hyperactivity disorder in a Korean sample.
18794726 2008 Beta-1-adrenoceptor genetic variants and ethnicity independently affect response to beta-blockade.
18776959 Beta1- and alpha2c-adrenoreceptor variants as predictors of clinical aspects of dilated cardiomyopathy in people of African ancestry.
18702968 2008 Lack of association between adrenergic receptor genotypes and survival in heart failure patients treated with carvedilol or metoprolol.
18698227 2008 Genetic variants in the alpha2C-adrenoceptor and G-protein contribute to ethnic differences in cardiovascular stress responses.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18511740 2008 Candidate genes and sensory functions in health and irritable bowel syndrome.
18487435 2008 Cyclic AMP acts through Rap1 and JNK signaling to increase expression of cutaneous smooth muscle alpha2C-adrenoceptors.
18435421 2008 Autoradiographic characterization of alpha(2C)-adrenoceptors in the human striatum.
18320080 The alpha 2C Del322-325 adrenergic receptor polymorphism is not associated with heart failure due to idiopathic dilated cardiomyopathy in black Africans.
18308161 2008 Neural control of heart rate is an arrhythmia risk modifier in long QT syndrome.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18075481 2007 Association study between Tourette's syndrome and polymorphisms of noradrenergic genes (ADRA2A, ADRA2C).
18071056 2008 Ethnic and genetic determinants of cardiovascular response to the selective alpha 2-adrenoceptor agonist dexmedetomidine.
17971028 2008 An exploratory study of the association of adrenergic and serotonergic genotype and gastrointestinal motor functions.
17655760 2007 Do motor control genes contribute to interindividual variability in decreased movement in patients with pain?
17644575 2007 Estrogen increases smooth muscle expression of alpha2C-adrenoceptors and cold-induced constriction of cutaneous arteries.
17496726 2007 Synergistic polymorphisms of beta1 and alpha2C-adrenergic receptors and the influence on left ventricular ejection fraction response to beta-blocker therapy in heart failure.
17383306 2007 A prospective evaluation of left ventricular remodeling after inaugural anterior myocardial infarction as a function of gene polymorphisms in the renin-angiotensin-aldosterone, adrenergic, and metalloproteinase systems.
17351367 2007 Effect of the alpha2C-adrenoreceptor deletion322-325 variant on sympathetic activity and cardiovascular measures in healthy subjects.
17223428 2007 Relation of beta(2)-adrenoceptor haplotype to risk of death and heart transplantation in patients with heart failure.
17215105 2007 Delayed transactivation of the receptor for nerve growth factor is required for sustained signaling and differentiation by alpha2-adrenergic receptors in transfected PC12 cells.
17192578 2006 Alpha 2-adrenergic receptors decrease DNA replication and cell proliferation and induce neurite outgrowth in transfected rat pheochromocytoma cells.
17075692 2007 Alpha-adrenoceptor gene variants and autonomic nervous system function in a young healthy Japanese population.
16636200 2006 Do allelic variants in alpha2A and alpha2C adrenergic receptors predispose to hypertension in blacks?
16605244 2006 Alpha2A- and alpha2C-adrenergic receptors form homo- and heterodimers: the heterodimeric state impairs agonist-promoted GRK phosphorylation and beta-arrestin recruitment.
16569551 2006 Common adrenergic receptor polymorphisms as novel risk factors for vasospastic angina.
16531006 2006 Interaction of the amyloid precursor like protein 1 with the alpha2A-adrenergic receptor increases agonist-mediated inhibition of adenylate cyclase.
16464220 2006 A study of candidate genotypes associated with dyspepsia in a U.S. community.
16407897 2006 Effects of a alpha 2C-adrenoreceptor gene polymorphism on neural responses to facial expressions in depression.
16299019 2006 Alpha2C-adrenoceptor polymorphism is associated with improved event-free survival in patients with dilated cardiomyopathy.
16187973 2005 No positive association between adrenergic receptor variants of alpha2cDel322-325, beta1Ser49, beta1Arg389 and the risk for heart failure in the Japanese population.
15946904 2005 A screen of candidate genes and influence of beta2-adrenergic receptor genotypes in postural tachycardia syndrome.
15920038 2005 Genetic variation at the human alpha2B-adrenergic receptor locus: role in blood pressure variation and yohimbine response.
15861038 2005 Sympathoneural and adrenomedullary functional effects of alpha2C-adrenoreceptor gene polymorphism in healthy humans.
15719258 2005 Functional adrenergic receptor polymorphisms and idiopathic orthostatic intolerance.
15683753 2005 Identification of a naturally occurring 21 bp deletion in alpha 2c noradrenergic receptor gene and cognitive correlates to antipsychotic treatment.
15592690 2005 Haplotype-based analysis of alpha 2A, 2B, and 2C adrenergic receptor genes captures information on common functional loci at each gene.
15542284 2004 Interaction between cardiac sympathetic drive and heart rate in heart failure: modulation by adrenergic receptor genotype.
15345481 2005 Distinct cAMP signaling pathways differentially regulate alpha2C-adrenoceptor expression: role in serum induction in human arteriolar smooth muscle cells.
15319474 2004 Polymorphisms of cardiac presynaptic alpha2C adrenergic receptors: Diverse intragenic variability with haplotype-specific functional effects.
12946937 2004 Regulation of alpha(2)-adrenoceptors in human vascular smooth muscle cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374873 2002 Synergistic polymorphisms of beta1- and alpha2C-adrenergic receptors and the risk of congestive heart failure.
12210281 2002 Norepinephrine transporter and alpha(2c) adrenoceptor allelic variants and personality factors.
11317218 2001 An in-frame deletion in the alpha(2C) adrenergic receptor is common in African--Americans.
11313909 2001 G(z) signaling: emerging divergence from G(i) signaling.
11140838 2000 A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory.
10945659 2000 Multivariate analysis of associations of 42 genes in ADHD, ODD and conduct disorder.
10801795 2000 A four amino acid deletion polymorphism in the third intracellular loop of the human alpha 2C-adrenergic receptor confers impaired coupling to multiple effectors.
10647009 1999 Two functionally distinct alpha2-adrenergic receptors regulate sympathetic neurotransmission.
10224112 1999 The zeta isoform of 14-3-3 proteins interacts with the third intracellular loop of different alpha2-adrenergic receptor subtypes.
10196213 1999 Role of arrestins in endocytosis and signaling of alpha2-adrenergic receptor subtypes.
9371698 1997 Molecular cloning, sequencing and functional study of the promoter region of the human alpha2C4-adrenergic receptor gene.
9235896 1997 A novel interaction between adrenergic receptors and the alpha-subunit of eukaryotic initiation factor 2B.
8188260 1994 Precise mapping of the brain alpha 2-adrenergic receptor gene within chromosome 4p16.
7688069 1993 Human alpha 2-adrenergic receptor subtype distribution: widespread and subtype-selective expression of alpha 2C10, alpha 2C4, and alpha 2C2 mRNA in multiple tissues.
2842764 1988 Cloning and expression of a human kidney cDNA for an alpha 2-adrenergic receptor subtype.
1849485 1991 Identification of an additional gene belonging to the alpha 2 adrenergic receptor family in the human genome by PCR.
1349607 1992 Factors determining the specificity of signal transduction by guanine nucleotide-binding protein-coupled receptors. II. Preferential coupling of the alpha 2C-adrenergic receptor to the guanine nucleotide-binding protein, Go.