Property Summary

Ligand Count 315
NCBI Gene PubMed Count 91
PubMed Score 93.46
PubTator Score 118.40

Knowledge Summary

Patent (4,176)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cardiomegaly 116 0.0 0.0
Fibrosis 44 0.0 0.0
Heart failure 162 0.0 0.0
Disease Target Count
Bipolar Disorder 666
Mood Disorders 184
Disease Target Count Z-score Confidence
Gilles de la Tourette syndrome 47 3.282 1.6
Pain agnosia 104 3.204 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 5.9e-04
astrocytoma -1.100 2.4e-02
breast carcinoma -1.100 2.5e-03
fibroadenoma -1.100 2.2e-02
glioblastoma -1.400 1.8e-05
lung adenocarcinoma -2.100 2.4e-07
lung cancer 2.200 1.3e-05
malignant mesothelioma 2.300 8.1e-07
non primary Sjogren syndrome sicca 1.100 1.2e-02
ovarian cancer 1.300 1.3e-05
primitive neuroectodermal tumor -1.100 4.1e-04
psoriasis -1.500 1.6e-38

 CSPA Cell Line (3)

Gene RIF (82)

AA Sequence

MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGFLIVFTVVGNV      1 - 70
LVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFGQVWCGVYLALDVLFCTSSIV     71 - 140
HLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISAVISFPPLVSLYRQPDGAAYPQCGLNDETWY    141 - 210
ILSSCIGSFFAPCLIMGLVYARIYRVAKLRTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPP    211 - 280
ADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASS    281 - 350
RSVEFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK    351 - 420
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ                                421 - 462
//

Text Mined References (91)

PMID Year Title