Property Summary

Ligand Count 167
NCBI Gene PubMed Count 118
PubMed Score 139.81
PubTator Score 148.31

Knowledge Summary

Patent (3,935)

TINX Plot

  Disease (8)

Disease Target Count P-value
psoriasis 6694 3.1e-21
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0
Disease Target Count Z-score Confidence
Hypertension 396 3.168 1.6
Coronary artery disease 268 3.056 1.5

Gene RIF (119)

AA Sequence

MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSL      1 - 70
ANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIA     71 - 140
AVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAK    141 - 210
GGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNS    211 - 280
GQGQKEGVCGASPEDEAEEEEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVG    281 - 350
AIGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS    351 - 420
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW                                            421 - 450
//

Text Mined References (119)

PMID Year Title