Property Summary

NCBI Gene PubMed Count 4
PubMed Score 6.14
PubTator Score 0.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 2254 1.1e-05
osteosarcoma 7933 9.8e-04
psoriasis 6685 2.3e-03
acute myeloid leukemia 785 4.7e-02

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.100 2.3e-03
osteosarcoma -1.106 9.8e-04
group 3 medulloblastoma 1.800 1.1e-05
acute myeloid leukemia -2.200 4.7e-02

Synonym

Accession Q3LIE5 A8K9B4 D3DTS4 Q9BVD4 Q9NRU8
Symbols MDS006
C17orf48
NBLA03831

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
25692488 Results from homology modeling and simulation studies of docking and molecular dynamics revealed the structural and dynamic information on human ADPRibase-Mn with the catalytic sites.
19460752 Knockdown of chromosome 17 open reading frame 48 (C17orf48) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWNNESSMPCCVL      1 - 70
QLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREYLTHSKLNTKFLEDQIVHHPE     71 - 140
TMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKYEQCMKILREHNPNTELNSPQGLSEPQFVQF    141 - 210
NGGFSQEQLNWLNEVLTFSDTNQEKVVIVSHLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTH    211 - 280
DGGYSEDPFGVYHVNLEGVIETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC            281 - 342
//

Text Mined References (8)

PMID Year Title
25692488 2015 Molecular bases of catalysis and ADP-ribose preference of human Mn2+-dependent ADP-ribose/CDP-alcohol diphosphatase and conversion by mutagenesis to a preferential cyclic ADP-ribose phosphohydrolase.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
18352857 2008 Mn2+-dependent ADP-ribose/CDP-alcohol pyrophosphatase: a novel metallophosphoesterase family preferentially expressed in rodent immune cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.