Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.68
PubTator Score 5.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.300 1.4e-03
Astrocytoma, Pilocytic 1.100 2.9e-06
atypical teratoid / rhabdoid tumor 1.100 2.9e-04
glioblastoma 1.500 1.3e-03
interstitial cystitis 1.300 1.7e-03
lung carcinoma -1.100 1.8e-14
medulloblastoma, large-cell 1.500 5.9e-06
non-small cell lung cancer -1.311 6.5e-25
osteosarcoma 1.479 2.8e-05
ovarian cancer 1.100 3.1e-10

Gene RIF (2)

AA Sequence

MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEA      1 - 70
GKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGL     71 - 140
RFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSG    141 - 210
YFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYD    211 - 280
AVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSK    281 - 350
EDTVISL                                                                   351 - 357
//

Text Mined References (10)

PMID Year Title