Property Summary

NCBI Gene PubMed Count 89
PubMed Score 254.96
PubTator Score 270.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Ischemia 28 0.0 0.0
Liver Cirrhosis, Experimental 733 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Vascular disease 294 3.347 1.7
Reflex epilepsy 3 3.122 1.6
Glaucoma 232 3.107 1.6

Protein-protein Interaction (6)

Gene RIF (61)

AA Sequence

MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIAVGVLVMPLAI      1 - 70
VVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKRVTTHRRIWLALGLCWLVSFL     71 - 140
VGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSL    141 - 210
NLSNSKETGAFYGREFKTAKSLFLVLFLFALSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPI    211 - 280
VYAYKIKKFKETYLLILKACVVCHPSDSLDTSIEKNSE                                    281 - 318
//

Text Mined References (90)

PMID Year Title