Property Summary

Ligand Count 904
NCBI Gene PubMed Count 110
PubMed Score 105.39
PubTator Score 52.58

Knowledge Summary

Patent (3,689)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.400 7.4e-03
group 3 medulloblastoma -1.900 9.0e-03
medulloblastoma, large-cell -1.700 1.4e-03
non-small cell lung cancer 1.208 8.5e-08
pancreatic cancer 1.300 1.7e-05
tuberculosis -1.800 3.0e-04

Gene RIF (94)

AA Sequence

MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLG      1 - 70
FCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTP     71 - 140
FLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVAC    141 - 210
RQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSH    211 - 280
ANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL                      281 - 332
//

Text Mined References (110)

PMID Year Title