Property Summary

NCBI Gene PubMed Count 307
PubMed Score 954.12
PubTator Score 555.51

Knowledge Summary

Patent (11,545)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7

Expression

Gene RIF (261)

AA Sequence

MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGF      1 - 70
CAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPM     71 - 140
LGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQ    141 - 210
MESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTN    211 - 280
SVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGS    281 - 350
APHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS            351 - 412
//

Text Mined References (308)

PMID Year Title