Property Summary

Ligand Count 1,180
NCBI Gene PubMed Count 115
PubMed Score 1177.85
PubTator Score 205.93

Knowledge Summary

Patent (6,975)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.300 4.6e-03
atypical teratoid / rhabdoid tumor -2.000 2.6e-04
ependymoma -1.500 1.2e-08
group 3 medulloblastoma -2.200 2.9e-04
malignant mesothelioma 1.300 1.3e-06
medulloblastoma, large-cell -1.500 4.1e-03
primitive neuroectodermal tumor -1.500 8.7e-03

 GWAS Trait (1)

Gene RIF (85)

AA Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILIN      1 - 70
IGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGL     71 - 140
TPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQ    141 - 210
LNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGN    211 - 280
SAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD                            281 - 326
//

Text Mined References (117)

PMID Year Title