Property Summary

Ligand Count 143
NCBI Gene PubMed Count 35
PubMed Score 339.97
PubTator Score 225.86

Knowledge Summary

Patent (25,369)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Hypermethioninemia 11 4.381 2.2
Adenosine deaminase deficiency 3 3.967 2.0

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.2e-02
ependymoma 1.100 7.1e-03
esophageal adenocarcinoma -1.300 2.0e-02
glioblastoma 1.100 3.9e-02
lung cancer 1.600 2.2e-03
medulloblastoma, large-cell 1.300 2.7e-02
Multiple myeloma 1.178 1.3e-02
ovarian cancer 1.500 2.8e-05
pancreatic ductal adenocarcinoma liver m... -2.404 7.9e-04
pediatric high grade glioma 1.300 1.4e-02
urothelial carcinoma -1.100 3.9e-02
Waldenstrons macroglobulinemia -1.844 7.0e-05

Gene RIF (17)

AA Sequence

MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELV      1 - 70
KKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTC     71 - 140
AACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIF    141 - 210
TLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVI    211 - 280
FTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRR    281 - 350
TGCTFPEKPDFH                                                              351 - 362
//

Text Mined References (42)

PMID Year Title