Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1824.52
PubTator Score 37.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (34)

Disease log2 FC p
malignant mesothelioma -3.400 5.2e-07
ependymoma -2.200 4.8e-02
esophageal adenocarcinoma -2.000 2.2e-02
psoriasis -2.100 1.7e-04
glioblastoma -2.700 2.1e-04
oligodendroglioma -1.200 5.3e-08
medulloblastoma -2.700 5.1e-07
atypical teratoid / rhabdoid tumor -3.000 1.2e-08
medulloblastoma, large-cell -3.100 2.0e-06
primitive neuroectodermal tumor -2.200 7.5e-03
Duchenne muscular dystrophy 1.572 1.9e-08
limb girdle muscular dystrophy 2A 1.700 5.7e-08
autosomal dominant Emery-Dreifuss muscul... 1.344 5.5e-03
Becker muscular dystrophy 1.205 2.1e-04
acute quadriplegic myopathy 1.925 5.6e-07
adrenocortical adenoma -1.249 1.1e-02
adrenocortical carcinoma -1.669 7.1e-05
non-small cell lung cancer -3.263 4.0e-24
intraductal papillary-mucinous adenoma (... -1.800 2.1e-03
intraductal papillary-mucinous carcinoma... -1.400 3.0e-02
intraductal papillary-mucinous neoplasm ... -1.900 2.3e-02
lung cancer -4.100 7.2e-07
active Crohn's disease -2.396 9.6e-03
ulcerative colitis -2.600 1.2e-06
interstitial cystitis -2.300 1.1e-04
lung adenocarcinoma -3.598 3.0e-13
adult high grade glioma -2.100 4.6e-04
invasive ductal carcinoma -3.200 2.7e-03
nasopharyngeal carcinoma -1.400 1.6e-03
lung carcinoma -1.200 2.2e-15
breast carcinoma -1.600 5.4e-10
ductal carcinoma in situ -2.500 1.4e-03
ovarian cancer -2.700 1.2e-07
pituitary cancer -1.500 7.2e-04

Synonym

Accession Q15847
Symbols AFRO
APM2
apM-2
C10orf116

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
23239344 Over-expressed in omental tissues from obese patients, C10orf16 manifested the characteristics of an adipocyte lineage-specific nuclear factor that can modulate the master adipogenesis transcription factors early during differentiation.
19444912 Overexpression of APM2 promote cisplatin resistance in cancer.
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGK      1 - 70
KFGLLK                                                                     71 - 76
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23467766 2013 Overexpression of C10orf116 promotes proliferation, inhibits apoptosis and enhances glucose transport in 3T3-L1 adipocytes.
23239344 2013 A Novel pro-adipogenesis factor abundant in adipose tissues and over-expressed in obesity acts upstream of PPAR? and C/EBP?.
21269460 2011 Initial characterization of the human central proteome.
19444912 2009 APM2 is a novel mediator of cisplatin resistance in a variety of cancer cell types regardless of p53 or MMR status.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8619847 1996 cDNA cloning and expression of a novel adipose specific collagen-like factor, apM1 (AdiPose Most abundant Gene transcript 1).