Property Summary

NCBI Gene PubMed Count 127
PubMed Score 115.02
PubTator Score 130.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 1.3e-06
spina bifida -1.149 4.0e-02
ductal carcinoma in situ -1.300 4.1e-03
ovarian cancer 1.600 3.8e-06
Down syndrome 1.100 7.4e-04

Protein-protein Interaction (2)

Gene RIF (132)

PMID Text
26631404 PCR results showed expression of adiponectin, AdipoR1, AdipoR2, follicle-stimulating hormone receptor (FSHR), and luteinizing hormone receptor (LHR) in granulosa cells (GCs). After controlling body mass index (BMI) values, qRT-PCR demonstrated a decreased expression of adiponectin system in GCs of polycystic ovary syndromepatients compared to those in controls
26459399 Endometriotic stromal cell proliferation is linked to increased expression of AdipoR2 (and AdipoR1) gene receptor expression.
26219823 Results identified miR-375 and its direct target, ADIPOR2 as androgen regulated molecules suggesting an important role in the mechanism of the increase in visceral fat mass and the associated insulin resistance caused by testosterone deficiency.
26146630 In conclusion, neutrophil AdipoRs (AdipoR1, AdipoR2) upregulation was associated with early stages of vascular injury, hypertension severity, and low serum levels of adiponectin
26111083 Two ADIPOR2 SNPs (rs11061925 and rs929434) were associated with fasting plasma triglyceride concentrations in the entire sample of HIV-infected patients.
25892445 Results demonstrate that the non-conserved N-terminal trunks dictate the cell-surface expression and temporal signaling profiles of AdipoR1 and AdipoR2.
25863129 These results strengthen the evidence for the role of AdipoR2 in prostate cancer progression.
25855295 crystal structures of the human adiponectin receptors AdipoR1 and AdipoR2 at 2.9 A and 2.4 A resolution, respectively
25640382 This study indicated that ApN may play a role in the progression of colorectal adenomatous polyps to carcinoma through actions on adipo-R1 and adipo-R2 receptors.
25575462 Data indicate the thermal stability of purified N-terminally truncated mutants of adiponectin receptors AdipoR1 and AdipoR2.
25392268 macrophage polarization is a key determinant regulating AdipoR expression and differential APN-mediated macrophage inflammatory responses
25337209 miR-423-3p plays a novel oncogenic role in laryngeal cancer via AdipoR2 suppression.
25299095 AA genotype and A allele of rs12342 in the adiponectin receptor 2 gene may increase the risk of ischemic stroke, particularly the risk of atherosclerosis cerebral infarction
25261236 AdipoR1 stimulates IL10 production by activating the AMPK and MAPKp38 pathways, whereas AdipoR2 modifies inflammatory processes by activating the COX-2 and PPARG pathways.
25126860 The improvement of insulin sensitivity by physical exercise is related to adiponectin and/or AdipoR1/R2 expression changes.
24969908 In those with advanced stage gastric cancer, 7 of 39 had low Adipo-R1 expression (17.9%) and 16 had low Adipo-R2 expression (41%).
24888493 down-regulation of adiponectin receptors (AdipoR1, R2, and T-cadherin) in osteoarthritic chondrocytes
24673523 In conclusion, all these observations suggest that adiponectin influences bone metabolism decreasing the levels of bone formation.
24619866 Low ADIPOR2 expression is associated with hepatocellular carcinoma.
23971629 adiponectin receptors(AdipoR1 and -R2 ) are located, or re-located, in the plasma membrane with distribution in the cytoplasm when mononuclear cells are committed to differentiate to osteoclasts.
23922494 APN, AdipoR1, and AdipoR2 exist in human and mouse retinas and retinal APN and AdipoR1 protein levels are elevated in type 1 diabetes mellitus mice.
23779096 AdipoR2 is regulated by the LH receptor function via a cAMP dependent mechanism.
23656997 SNPs of both the adiponectin gene and its receptors AdipoR1 and AdipoR2 (including their haplotypes) appear as candidate genes and involved in the development of the state of insulin resistance.
23386639 Circulating concentrations of adiponectin were not affected by type I diabetes, but expression of adiponectin receptors on blood monocytes was markedly reduced and inversely associated with insulin resistance.
23376713 Collectively these studies demonstrate that the non-conserved region of AdipoR2 restricts its cell-surface expression and raise the possibility that the majority of cell-surface AdipoR2 may be present in the form of heterodimers.
23358721 High AdipoR2 expression is associated with gastric carcinoma.
23355630 Studies indicate that altered levels of adiponectin and leptin or their cognate receptors in cancers can ultimately lead to an imbalance in downstream molecular pathways.
23255609 The pleiotropic, tissue-dependent functions of adiponectin depend on the expression levels of AdipoR1 and AdipoR2.
22907586 Data indicate that AdipoR1 was expressed in 27 % of primary tumors and AdipoR2 in 47 %.
22819899 Reduced hepatic expression of adiponectin and adipoR2 might be of pathophysiological relevance in chronic hepatitis B patients with metabolic syndrome.
22633650 Adiponectin differentially alters the expression of Adipor1/Adipor2 as well as genes related to steroidogenesis, ovulation, and apoptosis in cumulus cells versus granulosa cells.
22534793 Increased mRNA and protein expression of adiponectin receptors is related with increased aortic stiffness, coronary and peripheral atherosclerosis in patients with coronary artery disease.
22479352 Data suggest that RETN, IL8, ADIPOR2, LEPR, IL6, and TNF alpha may contribute to metabolic phenotypes in pregnant women.
22265003 Report expression of adiponectin, leptin, and their respective receptors in the human endometria of fertile women compared with women with unexplained recurrent implantation failure during the window of implantation.
22227293 Adiponectin suppression of macrophage lipid accumulation/foam cell formation is mediated through AdipoR1/AdipoR2/APPL1. AdipoR1 and AdipoR2 exhibited a differential ability to regulate inflammatory cytokines and SR-A1.
22187345 adiponectin receptor-2 795G/A polymorphisms and relation with insulin resistance
22082804 While the decrease in leptin receptor levels in chronic myeloid leukemia patients was confirmed, the increase in AdipoR1 levels and relevant decrease in AdipoR2 levels depicted their possible involvement in chronic myeloid leukemia pathogenesis.
21980131 In vitro and ex vivo evidence for a causal role of adiponectin in endometrial cancer.
21960694 Authors evaluated 29 common single-nucleotide polymorphisms (SNP) in ADIPOQ (n = 13), ADIPOR1 (n = 5), and ADIPOR2 (n = 11) in relation to the risk of prostate cancer.
21943112 In a Finnish type 2 diabetes population, four SNPs in ADIPOR2 (rs10848554, rs11061937, rs1058322, rs16928751) are associated with cardiovascular disease risk, and two remain significant.
21632074 Adiponectin levels and tissue expression of hormonal receptors seem to be associated not only with colorectal cancer risk but also with components of clinicopathological characteristics.
21538348 Data show that AdipoR1 and AdipoR2 are predominantly expressed intracellularly in peripheral blood T cells.
21351255 Low ADIPOR2 is associated withcolorectal cancer progression.
21331343 myocyte expression of peroxisome proliferator-activated receptor delta and the adiponectin receptors 1 and 2 and T-cadherin are highly coordinated and this might be of relevance for human lipid metabolism in vivo
21284833 Overweight patients with coronary artery disease compared to those without CAD, had decreased plasma adiponectin levels, as well as decreased surface expression of adiponectin receptors in peripheral monocytes.
21273992 SNP rs17366568 in ADIPOQ was significantly associated with serum adiponectin levels in white women only. No other SNPs (in ADIPOR1 and ADIPOR2) were associated with adiponectin or BMI among blacks or whites.
20875820 Studies indicate that APPL1 has been recently identified as an AdipoR1 and AdipoR2 binding protein.
20712903 Observational study of gene-disease association. (HuGE Navigator)
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20470935 Data suggest that low adiponectin receptors 1 and 2 in visceral adipocytes and adipose tissue and further suppression in adipose tissue of insulin-resistant animals indicate disturbed adiponectin bioactivity.
20423458 The ER stress-induced decrease in both protein and RNA of AdipoR2 results from a concomitant increase in expression of ATF3, which may play a role in the development of obesity-induced insulin resistance and related ER stress in hepatocytes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20336470 we found that two major receptors for adiponectin, AdipoR1 and AdipoR2, were both downregulated by malignant transformation in gastric epithelium
20308432 Observational study of gene-disease association. (HuGE Navigator)
20178558 findings suggest that variants of adiponectin receptor 2(ADIPOR2) could be a determinant for atherosclerosis independent of insulin resistance status
20178558 Observational study of gene-disease association. (HuGE Navigator)
20125105 Increased hepatic ADIPOR1 and ADIPOR2 mRNA in insulin-resistant obese subjects may, at least, reflect a compensatory mechanism for reduced plasma adiponectin, FOXO1 may contribute to enhanced ADIPOR1, but not ADIPOR2 transcription in insulin resistance.
20120899 the 6 SNPs of ADIPOQ and ADIPOR1/2 were not associated with a risk of polycystic ovary syndrome (PCOS); however, the 45T > G SNP in the ADIPOQ may be related to insulin resistance in Japanese women with PCOS
20032495 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19909601 AdipoR1 and 2 mRNA levels in non-obese women with PCOS were significantly lower than in controls. Adiponectin receptor expression is down-regulated by hyperinsulinaemia in non-obese women with PCOS, resulting in adiponectin resistance.
19887569 The mRNA expression of adiponectin and its receptors showed 24-h rhythmicity in human adipose tissue from morbidly obese patients.
19723917 No association between polymorphisms in ADIPOR2 and postmenopausal breast cancer was observed.
19723917 Observational study of gene-disease association. (HuGE Navigator)
19671624 AdipoR2 has a role in the regulation of steroid production in granulosa cells.
19662435 Observational study of gene-disease association. (HuGE Navigator)
19631916 Case-control study using 11 SNPs of ADIPOQ, ADIPOR1, and ADIPOR2 showed only the ADIPOQ gene as a possible risk factor for type 2 diabetes in Han Chinese population.
19631916 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19549705 Messenger RNA expression of adiponectin receptors (AdipoR1 and AdipoR2) in chondrosarcoma patients and chondrosarcoma cell lines were significantly higher than the normal cartilage.
19502591 Results suggest that fatty acids and ER stress reduce AdipoR2 protein and pAMPK levels.
19487733 Expression of Adipo-R2, but not Adipo-R1, is observed in the cytoplasm of both placental cytotrophoblasts and syncytiotrophoblasts of mild preeclempsia, severe cases and normal pregnancy group.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19208777 Genetic variation, particularly in the ADIPOR2 gene, contributes to variation in hepatic fat accumulation in humans
19208777 Observational study of gene-disease association. (HuGE Navigator)
19120283 The distribution of adiponectin receptors on human peripheral blood mononuclear cells.
19051043 Pancreatic cancer expresses adiponectin receptor2 and is associated with hypoleptinemia and hyperadiponectinemia: a case-control study
19037660 In whites, six SNPs in ADIPOQ, one SNP in ADIPOR1 and one SNP in ADIPOR2 were associated with insulin sensitivity at the P<0.05 level.
18996753 The lack of correlation between changes in SAT adiponectin gene and protein expression and its circulating levels suggests that adipose tissue synthesis and release of adiponectin are highly regulated pathways.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18988888 Upregulation in endothelial cells potentiates the antiinflammatory effect of adiponectin, which may apply to cardiovascular complcation in diabetes.
18931038 Observational study of gene-disease association. (HuGE Navigator)
18923878 AdipoR2 is overexpressed in liver in obese patients with nonalcoholic steatohepatitis.
18842004 In a HEK293 cell model, we found that downregulating AdipoR1/R2 simultaneously, but not individually, by RNA interference attenuated adiponectin-induced ERK1/2 activation, suggesting that either receptor was sufficient to mediate the response.
18719649 ADIPOR2 SNPs are associated with liver function tests in T2DM subjects, suggesting a possible role of this receptor in liver dysfunction associated with insulin resistance.
18719649 Observational study of gene-disease association. (HuGE Navigator)
18713296 Expression of AIDIPOR2 was determined in livers of morbidly obese patients with non-alcoholic fatty liver disease.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18548168 Observational study of gene-disease association. (HuGE Navigator)
18466348 None of the SNPs in either ADIPOR1 or ADIPOR2 were associated with the risk of type 2 diabetes in Koreans. SNPs of ADIPOR2 were associated with waist circumference.
18466348 Observational study of gene-disease association. (HuGE Navigator)
18363889 Dexamethasone inhibits AdipoR2 mRNA expression in nondiabetic subjects.
18310295 evated ADIPOR2 expression is associated with colorectal carcinomas but not in gastrointestinal stromal tumors
18294218 Observational study of gene-disease association. (HuGE Navigator)
18075289 Observational study of gene-disease association. (HuGE Navigator)
18075289 +33371 A/G polymorphism is associated with increased risk of T2DM and multiple insulin resistance-related phenotypes (including fasting plasma glucose, fasting serum triglycerides, and BMI) in the Chinese population
17716299 role of polymorphisms in the adiponectin receptor 1 and 2 genes (ADIPOR1 and ADIPOR2) in insulin resistance and type 2 diabetes [review]
17697862 Lower AdipoR after kidney transplantation may be secondary to immunosuppression and/or an improvement in glomerular filtration rate and the uremic milieu.
17459059 Adiponectin negatively regulates the progression of gastric cancer cells possibly through AdipoR2.
17426101 Plasma adiponectin and muscle gene expression of its specific receptors are controlled by genetic and several specific nongenetic factors
17416799 Observational study of gene-disease association. (HuGE Navigator)
17416799 No support for a relation between ADIPOR2 variability and risk of type 2 diabetes in women.
17216283 Observational study of gene-disease association. (HuGE Navigator)
17216283 Genetic variation in ADIPOR2 is not a major cause of extreme insulin resistance in humans, nor does it contribute in a significant manner to type 2 diabetes risk and related traits in UK Europid populations.
17209173 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17123704 possibility that adiponectin might modulate the growth of normal breast epithelial cells and breast cancer cells directly through AdipoR1 and AdipoR2 receptors
17118803 AdipoR1 and AdipoR2 are integral membrane proteins with the predicted topology--an intracellular N-terminus and an extracellular C-terminus
17054465 We observed the expression of adiponectin, AdipoR1 and AdipoR2 in the MG-63 cell line and the osteoblastic cell line differentiated from human mesenchymal stem cells.
17006986 Reduced circulating adiponectin occurs in rat fatty liver disease, but it is elevated in a mouse cirrhosis with similar findings in humans. Diminished hepatic expression of adiponectin receptors (AdipoR2 and AdipoR1) was only found in liver cirrhosis.
17001470 Upregulated in insulin-resistant women with polycystic ovary syndrome.
16955209 Observational study of gene-disease association. (HuGE Navigator)
16899222 may contribute to the molecular association between obesity and prostate cancer through a complex interaction with other hormones and cytokines that also play important roles in the pathophysiology of obesity and prostate cancer.
16724230 Observational study of gene-disease association. (HuGE Navigator)
16700915 Observational study of gene-disease association. (HuGE Navigator)
16700915 3 variants were found: (+795G/A, +870C/A & +963C/T) in linkage disequilibrium (r2 = 1) with a minor allele frequency of 0.125. This haplotype had higher plasma adiponectin levels & lower fasting triglyceride, VLDL-triglyceride & VLDL-cholesterol levels.
16678125 Here we show that MCF-7 cells express adiponectin receptors and respond to human recombinant adiponectin by reducing their growth, AMPkinase activation, and p42/p44 MAPkinase
16609881 Rosiglitazone can elevate the expression of ADIPOR2 in hepatocytes which caninteract functionally with a glucocorticoid receptor in the ADIPOR2 promoter to mediate stimulation of transcription.
16601138 adiponectin receptors have roles in the human endometrium
16505255 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16205883 Observational study of gene-disease association. (HuGE Navigator)
16139921 In patients with chronic hepatitis c, adiponectin and receptors(AdipoR1 and AdipoR2)play a role in hepatic inflammation in both sexes and liver steatosis in males.
15983228 Observational study of gene-disease association. (HuGE Navigator)
15983228 Evidence for association between variation in the adiponectin receptor 2 and type 2 diabetes among Amish.
15918014 Observational study of gene-disease association. (HuGE Navigator)
15918014 Genetic variations in ADIPOR2 are unlikely to lead to a common genetic predisposition to insulin resistance or type 2 diabetes in the Japanese population.
15757860 Plasma adiponection and adiponectin receptor 1 and 2 mRNA expression in muscle are not acutely regulated by adipose tissue lipolysis and/or plasma FFA. Adiponectin is abundantly expressed in muscle and is present in/on sarcolemma of muscle fibres.
15454091 a link between adiponectin and bone homeostasis by demonstrating transcription, translation, and secretion of adiponectin, as well as expression of its receptors, AdipoR1 and AdipoR2, in bone-forming cells
15331527 myotube mRNA levels of both receptors are associated with distinct metabolic functions but not with insulin sensitivity; AdipoR1, but not AdipoR2, expression correlated with insulin secretion.
15105989 Epression levels of AdipoRw as well as plasma adiponectin concentration were lower in people with a family history of Type 2.
14651988 Here we report the marked expression of mRNAs for the adiponectin receptors AdipoR1 and AdipoR2 in human and rat pancreatic beta cells, at levels similar to liver and greater than muscle.
12802337 cloning of cDNAs encoding adiponectin receptors 1 and 2 (AdipoR1 and AdipoR2) by expression cloning [AdipoR1 & AdipoR2]

AA Sequence

MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQ      1 - 70
EDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIF     71 - 140
RIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEG    141 - 210
VSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAG    211 - 280
VFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQL    281 - 350
FHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL                                      351 - 386
//

Text Mined References (128)

PMID Year Title
26631404 2016 Downregulation of adiponectin system in granulosa cells and low levels of HMW adiponectin in PCOS.
26459399 2016 in vitro Anti-Proliferative Effect of Adiponectin on Human Endometriotic Stromal Cells through AdipoR1 and AdipoR2 Gene Receptor Expression.
26219823 2015 Inhibition of adipogenic differentiation of human SGBS preadipocytes by androgen-regulated microRNA miR-375.
26146630 2015 Expression of Adiponectin Receptors on Peripheral Blood Leukocytes of Hypertensive Children Is Associated with the Severity of Hypertension.
26111083 2015 Polymorphisms in adiponectin receptor genes are associated with lipodystrophy-related phenotypes in HIV-infected patients receiving antiretroviral therapy.
25892445 2015 Characterisation of the adiponectin receptors: Differential cell-surface expression and temporal signalling profiles of AdipoR1 and AdipoR2 are regulated by the non-conserved N-terminal trunks.
25863129 2015 Tumor expression of adiponectin receptor 2 and lethal prostate cancer.
25855295 2015 Crystal structures of the human adiponectin receptors.
25640382 2015 Adipo-R1 and adipo-R2 expression in colorectal adenomas and carcinomas.
25575462 2015 Expression, purification, crystallization, and preliminary X-ray crystallographic studies of the human adiponectin receptors, AdipoR1 and AdipoR2.
25392268 2015 Macrophage polarization phenotype regulates adiponectin receptor expression and adiponectin anti-inflammatory response.
25337209 2014 microRNA-423-3p promotes tumor progression via modulation of AdipoR2 in laryngeal carcinoma.
25299095 2014 Association between adiponectin receptor 2 gene polymorphisms and cerebral infarction.
25261236 2014 Adiponectin receptor signaling on dendritic cells blunts antitumor immunity.
25126860 2014 Regulation of insulin sensitivity by adiponectin and its receptors in response to physical exercise.
24969908 2014 Lack of any prognostic relationship between adiponectin receptor (Adipo R1/R2) expression for early/advanced stage gastric cancer.
24888493 2014 Down-regulation of adiponectin receptors in osteoarthritic chondrocytes.
24673523 2014 Differential effects of adiponectin in osteoblast-like cells.
24619866 2014 Adiponectin receptor expression predicts favorable prognosis in cases of hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23971629 2013 Adiponectin receptors are present in RANK-L-induced multinucleated osteoclast-like cells.
23922494 2013 Expression of adiponectin and its receptors in type 1 diabetes mellitus in human and mouse retinas.
23779096 2013 Activation of the LH receptor up regulates the type 2 adiponectin receptor in human granulosa cells.
23656997 Single-nucleotide polymorphisms in adiponectin, AdipoR1, and AdipoR2 genes: insulin resistance and type 2 diabetes mellitus candidate genes.
23386639 2013 Inhibition of islet immunoreactivity by adiponectin is attenuated in human type 1 diabetes.
23376713 2013 Characterisation of the adiponectin receptors: the non-conserved N-terminal region of AdipoR2 prevents its expression at the cell-surface.
23358721 2013 Adiponectin receptor expression in gastric carcinoma: implications in tumor development and progression.
23355630 2013 Molecular pathways: adiponectin and leptin signaling in cancer.
23255609 2013 Adiponectin receptors form homomers and heteromers exhibiting distinct ligand binding and intracellular signaling properties.
22907586 2013 Expression and biologic significance of adiponectin receptors in papillary thyroid carcinoma.
22819899 2012 Adiponectin and its receptors in chronic hepatitis B patients with metabolic syndrome in China.
22633650 2012 Adiponectin and its receptors modulate granulosa cell and cumulus cell functions, fertility, and early embryo development in the mouse and human.
22534793 2012 Arterial stiffness is associated with increased monocyte expression of adiponectin receptor mRNA and protein in patients with coronary artery disease.
22479352 2012 The role of inflammatory pathway genetic variation on maternal metabolic phenotypes during pregnancy.
22379998 2012 Genome-wide mapping for clinically relevant predictors of lamotrigine- and phenytoin-induced hypersensitivity reactions.
22265003 2012 Adiponectin and leptin systems in human endometrium during window of implantation.
22227293 2012 Adiponectin-AdipoR1/2-APPL1 signaling axis suppresses human foam cell formation: differential ability of AdipoR1 and AdipoR2 to regulate inflammatory cytokine responses.
22187345 2012 Polymorphism of adiponectin (45T/G) and adiponectin receptor-2 (795G/A) in an Iranian population: relation with insulin resistance and response to treatment with pioglitazone in patients with type 2 diabetes mellitus.
22082804 2012 Aberrant expressions of leptin and adiponectin receptor isoforms in chronic myeloid leukemia patients.
21980131 2011 Direct role of adiponectin and adiponectin receptors in endometrial cancer: in vitro and ex vivo studies in humans.
21960694 2011 Common polymorphisms in the adiponectin and its receptor genes, adiponectin levels and the risk of prostate cancer.
21943112 2011 Association of ADIPOR2 gene variants with cardiovascular disease and type 2 diabetes risk in individuals with impaired glucose tolerance: the Finnish Diabetes Prevention Study.
21632074 2011 Serum adiponectin levels and tissue expression of adiponectin receptors are associated with risk, stage, and grade of colorectal cancer.
21538348 2011 Adiponectin is a negative regulator of antigen-activated T cells.
21351255 2010 Adiponectin and adiponectin receptor in relation to colorectal cancer progression.
21331343 2011 The myocyte expression of adiponectin receptors and PPAR? is highly coordinated and reflects lipid metabolism of the human donors.
21284833 2011 Adiponectin levels and expression of adiponectin receptors in isolated monocytes from overweight patients with coronary artery disease.
21273992 2011 ADIPOQ, ADIPOR1, and ADIPOR2 polymorphisms in relation to serum adiponectin levels and BMI in black and white women.
20875820 2010 Adiponectin receptor binding proteins--recent advances in elucidating adiponectin signalling pathways.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20470935 2010 Low-abundant adiponectin receptors in visceral adipose tissue of humans and rats are further reduced in diabetic animals.
20423458 2010 AdipoR2 is transcriptionally regulated by ER stress-inducible ATF3 in HepG2 human hepatocyte cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20336470 2010 Adiponectin receptors are downregulated in human gastric cancer.
20308432 2010 Association analysis of 33 lipoprotein candidate genes in multi-generational families of African ancestry.
20178558 2010 Genetic variation in the adiponectin receptor 2 (ADIPOR2) gene is associated with coronary artery disease and increased ADIPOR2 expression in peripheral monocytes.
20125105 2010 Hepatic adiponectin receptors (ADIPOR) 1 and 2 mRNA and their relation to insulin resistance in obese humans.
20120899 Association of single nucleotide polymorphisms in adiponectin and its receptor genes with polycystic ovary syndrome.
20032495 2010 Gene-nutrient interactions in the metabolic syndrome: single nucleotide polymorphisms in ADIPOQ and ADIPOR1 interact with plasma saturated fatty acids to modulate insulin resistance.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19909601 2009 Omental fat expression of adiponectin and adiponectin receptors in non-obese women with PCOS: a preliminary study.
19887569 2010 Circadian expression of adiponectin and its receptors in human adipose tissue.
19723917 2009 No association between polymorphisms in LEP, LEPR, ADIPOQ, ADIPOR1, or ADIPOR2 and postmenopausal breast cancer risk.
19671624 2009 Role of adiponectin receptors, AdipoR1 and AdipoR2, in the steroidogenesis of the human granulosa tumor cell line, KGN.
19662435 2009 Modifier gene study of meconium ileus in cystic fibrosis: statistical considerations and gene mapping results.
19631916 2009 Association study of the single nucleotide polymorphisms in adiponectin-associated genes with type 2 diabetes in Han Chinese.
19549705 2009 Involvement of AdipoR receptor in adiponectin-induced motility and alpha2beta1 integrin upregulation in human chondrosarcoma cells.
19502591 2009 Fenofibrate and PBA prevent fatty acid-induced loss of adiponectin receptor and pAMPK in human hepatoma cells and in hepatitis C virus-induced steatosis.
19487733 2009 Expressions of adiponectin receptors in placenta and their correlation with preeclampsia.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19208777 2009 Genetic variation in the ADIPOR2 gene is associated with liver fat content and its surrogate markers in three independent cohorts.
19120283 2008 The distribution of adiponectin receptors on human peripheral blood mononuclear cells.
19051043 2009 Pancreatic cancer expresses adiponectin receptors and is associated with hypoleptinemia and hyperadiponectinemia: a case-control study.
19037660 2009 The association of SNPs in ADIPOQ, ADIPOR1, and ADIPOR2 with insulin sensitivity in a cohort of adolescents and their parents.
18996753 Response of adiponectin and its receptors to changes in metabolic state after gastric bypass surgery: dissociation between adipose tissue expression and circulating levels.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18988888 2009 Overexpression of adiponectin receptors potentiates the antiinflammatory action of subeffective dose of globular adiponectin in vascular endothelial cells.
18931038 2009 Genome-wide linkage scan for genes influencing plasma triglyceride levels in the Veterans Administration Genetic Epidemiology Study.
18923878 2009 Pattern of expression of adiponectin receptors in human liver and its relation to nonalcoholic steatohepatitis.
18842004 2008 The adiponectin receptors AdipoR1 and AdipoR2 activate ERK1/2 through a Src/Ras-dependent pathway and stimulate cell growth.
18719649 2008 Association of ADIPOR2 with liver function tests in type 2 diabetic subjects.
18713296 2009 Expression of adiponectin and its receptors in livers of morbidly obese patients with non-alcoholic fatty liver disease.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18548168 2008 Adiponectin and adiponectin receptor gene variants in relation to type 2 diabetes and insulin resistance-related phenotypes.
18466348 2009 Polymorphisms of ADIPOR1 and ADIPOR2 are associated with phenotypes of type 2 diabetes in Koreans.
18363889 2008 Adiponectin, skeletal muscle adiponectin receptor expression and insulin resistance following dexamethasone.
18310295 2008 Adiponectin receptor expression is elevated in colorectal carcinomas but not in gastrointestinal stromal tumors.
18294218 2008 Associations between glucose tolerance, insulin sensitivity and insulin secretion phenotypes and polymorphisms in adiponectin and adiponectin receptor genes in the Quebec Family Study.
18075289 2007 Association of the +33371 A/G polymorphism in adiponectin receptor 2 gene with Type 2 diabetes in the Chinese population.
17716299 2007 Polymorphisms in adiponectin receptor genes ADIPOR1 and ADIPOR2 and insulin resistance.
17697862 2007 The effect of renal transplantation on adiponectin and its isoforms and receptors.
17459059 2007 Adiponectin inhibits the growth and peritoneal metastasis of gastric cancer through its specific membrane receptors AdipoR1 and AdipoR2.
17426101 2007 Relationships of plasma adiponectin level and adiponectin receptors 1 and 2 gene expression to insulin sensitivity and glucose and fat metabolism in monozygotic and dizygotic twins.
17416799 2007 Variations in adiponectin receptor genes and susceptibility to type 2 diabetes in women: a tagging-single nucleotide polymorphism haplotype analysis.
17216283 2007 Adiponectin receptor genes: mutation screening in syndromes of insulin resistance and association studies for type 2 diabetes and metabolic traits in UK populations.
17209173 2007 Adiponectin and adiponectin receptor gene variants in relation to resting metabolic rate, respiratory quotient, and adiposity-related phenotypes in the Quebec Family Study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17123704 2007 Demonstration of adiponectin receptors 1 and 2 mRNA expression in human breast cancer cells.
17118803 2006 Localization of novel adiponectin receptor constructs.
17054465 2006 Identification of adiponectin and its receptors in human osteoblast-like cells and association of T45G polymorphism in exon 2 of adiponectin gene with lumbar spine bone mineral density in Korean women.
17006986 2006 Adiponectin and its receptors in rodent models of fatty liver disease and liver cirrhosis.
17001470 2006 Upregulation of adiponectin receptor 1 and 2 mRNA and protein in adipose tissue and adipocytes in insulin-resistant women with polycystic ovary syndrome.
16955209 2006 Association between variants in the genes for adiponectin and its receptors with insulin resistance syndrome (IRS)-related phenotypes in Mexican Americans.
16899222 2006 The regulation of adiponectin receptors in human prostate cancer cell lines.
16724230 2006 Association of sequence variations in the gene encoding adiponectin receptor 1 (ADIPOR1) with body size and insulin levels. The Finnish Diabetes Prevention Study.
16700915 2006 Genetic variants of adiponectin receptor 2 are associated with increased adiponectin levels and decreased triglyceride/VLDL levels in patients with metabolic syndrome.
16678125 2006 Adiponectin mediates antiproliferative and apoptotic responses in human MCF7 breast cancer cells.
16609881 2006 Regulation of adiponectin receptors in hepatocytes by the peroxisome proliferator-activated receptor-gamma agonist rosiglitazone.
16601138 2006 Expression of adiponectin receptors and its possible implication in the human endometrium.
16505255 2006 Genetic analysis of ADIPOR1 and ADIPOR2 candidate polymorphisms for type 2 diabetes in the Caucasian population.
16205883 2005 Polymorphisms in the gene encoding adiponectin receptor 1 are associated with insulin resistance and high liver fat.
16139921 2005 Adiponectin and its receptors in patients with chronic hepatitis C.
16044242 2005 PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif.
15983228 2005 Genetic variation in adiponectin receptor 1 and adiponectin receptor 2 is associated with type 2 diabetes in the Old Order Amish.
15918014 2005 Absence of an association between the polymorphisms in the genes encoding adiponectin receptors and type 2 diabetes.
15757860 2005 The effects of exercise and adipose tissue lipolysis on plasma adiponectin concentration and adiponectin receptor expression in human skeletal muscle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454091 2004 Adiponectin and its receptors are expressed in bone-forming cells.
15331527 2004 Expression of adiponectin receptor mRNA in human skeletal muscle cells is related to in vivo parameters of glucose and lipid metabolism.
15105989 2004 Adiponectin receptors gene expression and insulin sensitivity in non-diabetic Mexican Americans with or without a family history of Type 2 diabetes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14651988 2003 Expression of adiponectin receptors in pancreatic beta cells.
12802337 2003 Cloning of adiponectin receptors that mediate antidiabetic metabolic effects.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.