Property Summary

NCBI Gene PubMed Count 191
PubMed Score 184.58
PubTator Score 191.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.540 1.5e-04
non primary Sjogren syndrome sicca 1.200 1.7e-02
invasive ductal carcinoma 1.100 4.8e-04

Protein-protein Interaction (3)

Gene RIF (200)

PMID Text
26741812 ADPOR1 variants, rs3737884*G and rs7514221*C, may be shared risk factors associated with CAD, T2D, and T2D with CAD in a population of northeast China.
26631404 PCR results showed expression of adiponectin, AdipoR1, AdipoR2, follicle-stimulating hormone receptor (FSHR), and luteinizing hormone receptor (LHR) in granulosa cells (GCs). After controlling body mass index (BMI) values, qRT-PCR demonstrated a decreased expression of adiponectin system in GCs of polycystic ovary syndromepatients compared to those in controls
26459399 Expression of AdipoR1 gene receptor was increased in endometriotic stromal cells.
26160610 miR-323 may increase VEGF-A-mediated cancer vascularization in PC cells through AdipoR1 suppression.
26146630 In conclusion, neutrophil AdipoRs (AdipoR1, AdipoR2) upregulation was associated with early stages of vascular injury, hypertension severity, and low serum levels of adiponectin
26111083 We did not find any significant associations with ADIPOR1 gene variants and fasting plasma triglycerides in HIV-infected patients.
26047008 The ADIPOR1 rs1342387(G/A) polymorphism, but not rs12733285(C/T) or rs7539542(C/G), may be associated with cancer risk, especially risk of colorectal cancer in Asians.
25892445 Results demonstrate that the non-conserved N-terminal trunks dictate the cell-surface expression and temporal signaling profiles of AdipoR1 and AdipoR2.
25855295 crystal structures of the human adiponectin receptors AdipoR1 and AdipoR2 at 2.9 A and 2.4 A resolution, respectively
25640382 This study indicated that ApN may play a role in the progression of colorectal adenomatous polyps to carcinoma through actions on adipo-R1 and adipo-R2 receptors.
25586350 we not only detected significant decreases in plasma adiponectin levels in prostate cancer patients, but also showed significant decreases in adiponectin receptor I (AdipoR1) levels in the resected prostate cancer specimen
25582653 Decreased AdipoR1 mRNA levels and increased circulating adiponectin in advanced stages of coronary artery disease implies that CAD could be related to 'adiponectin resistance'.
25575462 Data indicate the thermal stability of purified N-terminally truncated mutants of adiponectin receptors AdipoR1 and AdipoR2.
25516230 Data suggested that variant rs1342387 on ADIPOR1 may be a novel colorectal cancer susceptibility factor but not rs12733285 neither ADIPOQ variants rs266729, rs822395, rs2241766, and rs1501299.
25475722 Adiponectin Receptor 1 has a role in reversing imatinib resistance in K562 human chronic myeloid leukemia cells
25392268 macrophage polarization is a key determinant regulating AdipoR expression and differential APN-mediated macrophage inflammatory responses
25292021 ADIPOR1 rs1342387 polymorphism is significantly associated with risk of colorectal cancer
25261236 AdipoR1 stimulates IL10 production by activating the AMPK and MAPKp38 pathways, whereas AdipoR2 modifies inflammatory processes by activating the COX-2 and PPARG pathways.
25126860 The improvement of insulin sensitivity by physical exercise is related to adiponectin and/or AdipoR1/R2 expression changes.
25049200 uremia results in upregulation of AdipoR1 but adiponectin resistance at the post-receptor level.
24969908 In those with advanced stage gastric cancer, 7 of 39 had low Adipo-R1 expression (17.9%) and 16 had low Adipo-R2 expression (41%).
24967709 ADIPOR1 risk polymorphisms are a strong candidate for the "common soil" hypothesis and could partially contribute to disease susceptibility to T2D, CAD, and T2D with CAD in the Northern Han Chinese population
24888493 down-regulation of adiponectin receptors (AdipoR1, R2, and T-cadherin) in osteoarthritic chondrocytes
24673523 In conclusion, all these observations suggest that adiponectin influences bone metabolism decreasing the levels of bone formation.
24619866 Low ADIPOR1 expression is associated with hepatocellular carcinoma.
24335000 SNP rs1539355 in the ADIPOR1 gene is associated with insulin resistance in Chinese PCOS patients.
24104889 The present data suggest that the disturbed interaction of adiponectin with AMPK is located downstream of the AdipoR1 receptor.
24096711 established link between obesity and RCC can therefore be further explained by the adiponectin deficiency in obese individuals together with reduced AdipoR1 protein in RCC
23971629 adiponectin receptors(AdipoR1 and -R2 ) are located, or re-located, in the plasma membrane with distribution in the cytoplasm when mononuclear cells are committed to differentiate to osteoclasts.
23922494 APN, AdipoR1, and AdipoR2 exist in human and mouse retinas and retinal APN and AdipoR1 protein levels are elevated in type 1 diabetes mellitus mice.
23922112 SNPs in ADIPOR1 were associated with weight gain in women diagnosed with breast cancer.
23860432 these data suggest that AdipoR1 protein levels are regulated by so far uncharacterized class I PDZ proteins
23860143 Adiponectin receptor 1 may be strongly related to the stabilization of established atherosclerotic plaques via inactivating macrophages.
23813974 Genome-wide expression profiling identified the transcription of ADIPOR1, VAMP3 and C11ORF10 to be correlated with decreased ANRIL expression in a time-dependent manner.
23756394 AdipoR1 and leptin receptor protein levels were significantly higher in Barrett's esophagus patients compared to controls and obese controls.
23656997 SNPs of both the adiponectin gene and its receptors AdipoR1 and AdipoR2 (including their haplotypes) appear as candidate genes and involved in the development of the state of insulin resistance.
23500159 Adiponectin affects lung epithelial A549 cell viability counteracting TNFalpha and IL-1ss toxicity through AdipoR1.
23388528 non-alcoholic fatty liver disease patients, who were carriers of G allele rs6666089 ADIPOR1 had higher levels of visceral, subcutaneous adipose tissue and their relation and percentage of liver fat in comparison with ADIPOR1 A allele carriers
23386639 Circulating concentrations of adiponectin were not affected by type I diabetes, but expression of adiponectin receptors on blood monocytes was markedly reduced and inversely associated with insulin resistance.
23358721 High AdipoR1 expression is associated with gastric carcinoma.
23358237 Expression of adiponectin receptor 1 is indicative of favorable prognosis in non-small cell lung carcinoma.
23355630 Studies indicate that altered levels of adiponectin and leptin or their cognate receptors in cancers can ultimately lead to an imbalance in downstream molecular pathways.
23351195 genetic variation in ADIPOQ and its receptors does not appear to contribute to the risk of insulin resistance or metabolic syndrome but did for type 2 diabetes in a European-Australian population.
23293232 ADIPOR1 gene single nucleotide polymorphism (13423870) associated with the increased risk in cardiovascular diseases in patients with nonalcoholic fatty liver disease
23255609 The pleiotropic, tissue-dependent functions of adiponectin depend on the expression levels of AdipoR1 and AdipoR2.
22907586 Data indicate that AdipoR1 was expressed in 27 % of primary tumors and AdipoR2 in 47 %.
22842631 These data demonstrated that globular adiponectin prevents ethanol-induced apoptosis in HepG2 cells via HO-1 induction and revealed a novel biological response of globular adiponectin in the protection of liver injury from alcohol consumption.
22767440 genetic association study in population in Belgium (1,021 obese individuals): Data suggest that none of 9 SNPs covering entire AdipoR1 gene and surrounding 7 kb region are associated with obesity (in the entire population or in men/women separately).
22633650 Adiponectin differentially alters the expression of Adipor1/Adipor2 as well as genes related to steroidogenesis, ovulation, and apoptosis in cumulus cells versus granulosa cells.
22534793 Increased mRNA and protein expression of adiponectin receptors is related with increased aortic stiffness, coronary and peripheral atherosclerosis in patients with coronary artery disease.
22495003 ADIPOR1 rs16850799 and rs34010966 were significantly associated with femur neck bone mineral density (BMD) in postmenopausal Korean women; findings suggest that ADIPOR1 polymorphisms constitute one of the genetic determinants of BMD in postmenopausal Korean women
22387454 Our findings reveal that rs10753929 ADIPOR1 variant is a novel candidate for age-related macular degeneration genetic risk factor in Finnish population.
22340319 Findings suggest that AdipoR1 may mediate the difference in adiponectin-induced PGE2 production in rheumatoid arthritis and osteoarthritis.
22265003 Report expression of adiponectin, leptin, and their respective receptors in the human endometria of fertile women compared with women with unexplained recurrent implantation failure during the window of implantation.
22227293 Adiponectin suppression of macrophage lipid accumulation/foam cell formation is mediated through AdipoR1/AdipoR2/APPL1. AdipoR1 and AdipoR2 exhibited a differential ability to regulate inflammatory cytokines and SR-A1.
22186245 decreased expression in mild and moderate/severe persistent allergic nasal mucosa
22106445 Gene-environment interactions were observed with cigarette smoking and a single nucleotide polymorphism (SNP) in ADIPOR1 in African Americans, as well as between a different SNP in ADIPOR1 and physical activity in Caucasians.
22087284 Multifactor gene-environment interactions analysis revealed significant interactions between ADIPOQ rs1063538, ADIPOR1 rs1539355, smoking status and BMI.
22082804 While the decrease in leptin receptor levels in chronic myeloid leukemia patients was confirmed, the increase in AdipoR1 levels and relevant decrease in AdipoR2 levels depicted their possible involvement in chronic myeloid leukemia pathogenesis.
22078265 AdipoR1 was not an independent prognostic factor on patient's survival on gastric cancer.
22049178 Variants of the adiponectin and adiponectin receptor-1 genes and posttransplantation diabetes mellitus in renal allograft recipients.
21980131 In vitro and ex vivo evidence for a causal role of adiponectin in endometrial cancer.
21960694 Authors evaluated 29 common single-nucleotide polymorphisms (SNP) in ADIPOQ (n = 13), ADIPOR1 (n = 5), and ADIPOR2 (n = 11) in relation to the risk of prostate cancer.
21900123 Globular adiponectin possesses both AdipoR1-dependent ability to stimulate COX-2 expression and AdipoR1-independent effects related to expression of VCAM-1 and adhesion of monocytes to endothelium.
21761356 we report AdipoR1 and AdipoR2 in renal cell carcinoma, hepatocellular carcinoma, melanoma, cholangiocarcinoma, transitional cell carcinoma of the bladder, ovarian epithelial carcinoma, cervical squamous cell carcinoma and adrenocortical carcinoma
21750988 An interaction of the adiponectin receptor 1 with the tetrameric complex and protein kinase CK2 as a key player in adiponectin signaling, is reported.
21749709 The rs12733285C/T genotype and the carriage of the A allele of rs1342387 (A/G or A/A) in ADIPOR1 are the protective factors for colorectal cancer.
21632074 Adiponectin levels and tissue expression of hormonal receptors seem to be associated not only with colorectal cancer risk but also with components of clinicopathological characteristics.
21538348 Data show that AdipoR1 and AdipoR2 are predominantly expressed intracellularly in peripheral blood T cells.
21397927 5 ADIPOQ 4-single nucleotide polymorphisms (SNPs) haplotypes and 1 ADIPOR1 2-SNP haplotype tightly associated with prostate cancer risk.
21351255 Low ADIPOR1 is associated withcolorectal cancer progression.
21331343 myocyte expression of peroxisome proliferator-activated receptor delta and the adiponectin receptors 1 and 2 and T-cadherin are highly coordinated and this might be of relevance for human lipid metabolism in vivo
21321996 Adiponectin increases MMP-3 expression and activity by binding to the AdipoR1 receptor and activation of p38 and AMPK, resulting in the activations of NF-kB on the MMP-3 promoter and contribute cartilage destruction during arthritis
21289205 AdipoR1 receptor expression in human skeletal muscle is subjected to posttranscriptional regulation, including alternative splicing and translational control.
21284833 Overweight patients with coronary artery disease compared to those without CAD, had decreased plasma adiponectin levels, as well as decreased surface expression of adiponectin receptors in peripheral monocytes.
21273992 SNP rs17366568 in ADIPOQ was significantly associated with serum adiponectin levels in white women only. No other SNPs (in ADIPOR1 and ADIPOR2) were associated with adiponectin or BMI among blacks or whites.
21195057 These results indicated that AdipoR1 interacted with LTBR and mediated the inhibition of LTBR-activated NF-kappaB pathway.
20952631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20938443 the presence of a genetic variation in AdipoR1 is associated with decreased olfactory recognition in healthy subjects.
20938443 Observational study of gene-disease association. (HuGE Navigator)
20875820 Studies indicate that APPL1 has been recently identified as an AdipoR1 and AdipoR2 binding protein.
20712903 Observational study of gene-disease association. (HuGE Navigator)
20697428 Genetic variation in ADIPOQ and ADIPOR1 did not predict risk of prostate cancer in this study of African-American men. However, the rs1501299 SNP in ADIPOQ was associated with obesity.
20697428 Observational study of gene-disease association. (HuGE Navigator)
20696134 ATF3 acts as transcriptional repressor in the regulation of AdiopR1, which may impair adiponectin signaling under obesity and diabetic conditions.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20470935 Data suggest that low adiponectin receptors 1 and 2 in visceral adipocytes and adipose tissue and further suppression in adipose tissue of insulin-resistant animals indicate disturbed adiponectin bioactivity.
20432444 Adiponectin enhances BMP-2 expression in osteoblastic cells, and AdipoR1 receptor, AMPK, p38 and NF-kappaB signaling pathways may be involved in increasing BMP-2 expression by adiponectin.
20336470 we found that two major receptors for adiponectin, AdipoR1 and AdipoR2, were both downregulated by malignant transformation in gastric epithelium
20332107 Adiponectin decreases the receptor dimerization in a concentration-dependent manner.
20129487 in subjects with normal waist circumference, the prevalence of visceral fat obesity is lower and the expression of adiponectin and its receptor is higher in female subjects compared with male subjects
20125105 Increased hepatic ADIPOR1 and ADIPOR2 mRNA in insulin-resistant obese subjects may, at least, reflect a compensatory mechanism for reduced plasma adiponectin, FOXO1 may contribute to enhanced ADIPOR1, but not ADIPOR2 transcription in insulin resistance.
20120899 the 6 SNPs of ADIPOQ and ADIPOR1/2 were not associated with a risk of polycystic ovary syndrome (PCOS); however, the 45T > G SNP in the ADIPOQ may be related to insulin resistance in Japanese women with PCOS
20074551 these results establish ERp46 as the first AdipoR1-specific interacting protein and suggest a role for ERp46 in adiponectin receptor biology and adiponectin signalling.
20071013 The altered expression of AdipoR1 in invasive breast cancer compared to DCIS suggests that the receptor-binding protein adiponectin might exert growth inhibitory effects that are overcome in transformation of preinvasive to invasive breast cancer.
20059631 Observational study of gene-disease association. (HuGE Navigator)
20032495 Triacylglycerols, nonesterified fatty acids, and waist circumference were significantly different between genotypes for 2 SNPs (rs266729 in ADIPOQ and rs10920533 in ADIPOR1).
20032495 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19909601 AdipoR1 and 2 mRNA levels in non-obese women with PCOS were significantly lower than in controls. Adiponectin receptor expression is down-regulated by hyperinsulinaemia in non-obese women with PCOS, resulting in adiponectin resistance.
19887569 The mRNA expression of adiponectin and its receptors showed 24-h rhythmicity in human adipose tissue from morbidly obese patients.
19727342 Strong candidate gene for retinitis pigmentosa, AXPC1 (human 1q31-q32). Conclusion is based on a massive expression data set for mouse (103 strains) and joint analysis of RetNet database.
19723917 No association between polymorphisms in ADIPOR1 and postmenopausal breast cancer was observed.
19723917 Observational study of gene-disease association. (HuGE Navigator)
19672024 serum total and HMW Adp, and AdpR1 gene expressions in pheochromocytoma tissue, are associated with the level of catecholamine produced in the tumor
19671624 AdipoR1 has a role in cell survival.
19631916 Case-control study using 11 SNPs of ADIPOQ, ADIPOR1, and ADIPOR2 showed only the ADIPOQ gene as a possible risk factor for type 2 diabetes in Han Chinese population.
19631916 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19549705 Messenger RNA expression of adiponectin receptors (AdipoR1 and AdipoR2) in chondrosarcoma patients and chondrosarcoma cell lines were significantly higher than the normal cartilage.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19524379 A strong positive correlation between insulin as well as IGF1 receptor and AdipoR1, but not AdipoR2, expression could be observed.
19487733 Expression of Adipo-R2, but not Adipo-R1, is observed in the cytoplasm of both placental cytotrophoblasts and syncytiotrophoblasts of mild preeclempsia, severe cases and normal pregnancy group.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19233263 The regulatory subunit of protein kinase CK2 is identified as a novel intracellular partner of AdipoR1 and CK2 is shown to be an effector molecule in adiponectin signaling.
19208777 Observational study of gene-disease association. (HuGE Navigator)
19196212 placental expression level of the leptin and adiponectin receptor 1 genes was significantly higher in PE mothers than in controls.
19144434 The -8503G/A polymorphism of ADIPOR1 is not related to insulin sensitivity in either Japanese-Americans or Japanese.
19144434 Observational study of gene-disease association. (HuGE Navigator)
19120283 The distribution of adiponectin receptors on human peripheral blood mononuclear cells.
19109202 Human A549 epithelial cells express adiponectin type 1 receptors (but not AdipoR2) that are functional, as incubation of A549 cells with adiponectin induces release of IL-8.
19051043 Pancreatic cancer expresses adiponectin receptor1 and is associated with hypoleptinemia and hyperadiponectinemia: a case-control study.(625-33)
19037660 In whites, six SNPs in ADIPOQ, one SNP in ADIPOR1 and one SNP in ADIPOR2 were associated with insulin sensitivity at the P<0.05 level. In African Americans, two SNPs in ADIPOR1 were associated with insulin sensitivity at the P<0.05 level.
19010305 These results suggest that RACK1 may act as a key bridging factor in adiponectin signaling transduction through interacting with AdipoR1.
18996753 The lack of correlation between changes in SAT adiponectin gene and protein expression and its circulating levels suggests that adipose tissue synthesis and release of adiponectin are highly regulated pathways.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18988888 Upregulation in endothelial cells potentiates the antiinflammatory effect of adiponectin, which may apply to cardiovascular complcation in diabetes.
18982021 AdipoR1 is internalized through a clathrin- and Rab5-dependent pathway and that endocytosis may play a role in the regulation of adiponectin signaling.
18923878 AdipoR1 is overexpressed in liver in obese patients with nonalcoholic steatohepatitis.
18854016 our findings support that this region of the genome likely harbors susceptibility variants for obesity that are importantly different in type 2 diabetes individuals and those with normal glucose metabolic profile
18854016 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18842004 In a HEK293 cell model, we found that downregulating AdipoR1/R2 simultaneously, but not individually, by RNA interference attenuated adiponectin-induced ERK1/2 activation, suggesting that either receptor was sufficient to mediate the response.
18827209 Observational study of gene-disease association. (HuGE Navigator)
18719649 Observational study of gene-disease association. (HuGE Navigator)
18713296 Expression of AIDIPOR1 was determined in livers of morbidly obese patients with non-alcoholic fatty liver disease.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18622492 ADIPOR1 polymorphisms are unlikely to be major risk factors for DM2 or for metabolic/anthropometric measurements that represent risk factors for DM2 in populations of European and African ancestries.
18622492 Observational study of gene-disease association. (HuGE Navigator)
18599322 Single nucleotide polymorphism -11377C/G alters the sequence in one SP1 binding site in the adiponectin promoter region. This polymorphism and promoter SNP -11391G/A may confer susceptibility to development of nephropathy in type 1 diabetes patients.
18548168 Observational study of gene-disease association. (HuGE Navigator)
18466348 None of the SNPs in either ADIPOR1 or ADIPOR2 were associated with the risk of type 2 diabetes in Koreans. However, the altered activity of the ADIPOR1 promoter was associated with insulin resistance
18466348 Observational study of gene-disease association. (HuGE Navigator)
18451143 Association between functionally relevant variants of the adiponectin pathway and breast cancer risk.
18451143 Observational study of gene-disease association. (HuGE Navigator)
18313838 Data show that globular adiponectin, acting via adiponectin receptor-1, inhibits leptin-stimulated oesophageal adenocarcinoma cell proliferation.(
18310295 Elevated ADIPOR1 expression is associated with colorectal carcinomas but not in gastrointestinal stromal tumors
18294218 Observational study of gene-disease association. (HuGE Navigator)
18163210 adiponectin decreases breast cancer cell proliferation by inhibiting the entry into S-phase without inducing apoptosis, and this inhibitory effect is mediated through adiponectin receptor 1
18097620 Observational study of gene-disease association. (HuGE Navigator)
17911635 AdipoR1 receptor is involved in adiponectin-mediated increase of IL-6 production in synovial fibroblasts.
17878241 Physical training for 4 weeks resulted in increased AdipoR1 and AdipoR2 mRNA expression in subcutaneous fat and may insulin resistance.
17716299 role of polymorphisms in the adiponectin receptor 1 and 2 genes (ADIPOR1 and ADIPOR2) in insulin resistance and type 2 diabetes [review]
17712104 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17712104 Findings suggest not only that ADIPOR1 variants influence insulin resistance in the presence of adiposity, but also that these variants and haplotypes are protective in African Americans.
17697862 Lower AdipoR after kidney transplantation may be secondary to immunosuppression and/or an improvement in glomerular filtration rate and the uremic milieu.
17459059 Adiponectin negatively regulates the progression of gastric cancer cells possibly through AdipoR1.
17426101 Plasma adiponectin and muscle gene expression of its specific receptors are controlled by genetic and several specific nongenetic factors
17416799 Observational study of gene-disease association. (HuGE Navigator)
17416799 Significant associations between ADIPOR1 haplotypes and type 2 diabetes risk in women.
17285539 Findings suggest that variant of ADIPOR1 plays a role in glucose metabolism and insulin resistance in the Chinese.
17285539 Observational study of gene-disease association. (HuGE Navigator)
17216283 Observational study of gene-disease association. (HuGE Navigator)
17216283 Genetic variation in ADIPOR1is not a major cause of extreme insulin resistance in humans, nor does it contribute in a significant manner to type 2 diabetes risk and related traits in UK Europid populations.
17209173 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17123704 possibility that adiponectin might modulate the growth of normal breast epithelial cells and breast cancer cells directly through AdipoR1 and AdipoR2 receptors
17118803 AdipoR1 and AdipoR2 are integral membrane proteins with the predicted topology--an intracellular N-terminus and an extracellular C-terminus
17054465 We observed the expression of adiponectin, AdipoR1 and AdipoR2 in the MG-63 cell line and the osteoblastic cell line differentiated from human mesenchymal stem cells.
17006986 Reduced circulating adiponectin occurs in rat fatty liver disease, but it is elevated in a mouse cirrhosis with similar findings in humans. Diminished hepatic expression of adiponectin receptors (AdipoR2 and AdipoR1) was only found in liver cirrhosis.
17003341 Observational study of gene-disease association. (HuGE Navigator)
17003341 Our findings point to genetic variability at the ADIPOR1 locus as a strong determinant of coronary artery disease susceptibility in type 2 diabetes.
17001470 Upregulated in insulin-resistant women with polycystic ovary syndrome.
16955209 Observational study of gene-disease association. (HuGE Navigator)
16899222 May contribute to the molecular association between obesity and prostate cancer through complex interaction with other hormones and cytokines that play important roles in the pathophysiology of obesity and prostate cancer.
16793963 adiponectin receptor-1 expression increased in adipose tissue of impaired glucose-tolerant obese subjects during weight loss
16724230 Observational study of gene-disease association. (HuGE Navigator)
16724230 ADIPOR1 has a putative role in the development of body size, and traits for central adiposity and insulin resistance may be dissociated from each other.
16700915 Observational study of gene-disease association. (HuGE Navigator)
16678125 Here we show that MCF-7 cells express adiponectin receptors and respond to human recombinant adiponectin by reducing their growth, AMPkinase activation, and p42/p44 MAPkinase
16622416 APPL1 interacts with adiponectin receptors in mammalian cells and the interaction is stimulated by adiponectin.
16609881 Adiponectin is an adipocyte-derived hormone that plays a critical role in the development of type 2 diabetes via interaction with adiponectin receptors 1.
16601138 adiponectin receptors have roles in the human endometrium
16505255 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16443913 the A allele of the -8503 G/A SNP of the ADIPOR1 gene is associated with less insulin sensitivity only in more obese but not in lean individuals
16205883 Observational study of gene-disease association. (HuGE Navigator)
16205883 the -8503 G/A single-nucleotide polymorphism in the promoter or the -1927 T/C single-nucleotide polymorphism in intron 1 of ADIPOR1 may affect insulin sensitivity and liver fat in humans.
16139921 In patients with chronic hepatitis c, adiponectin and receptors(AdipoR1 and AdipoR2)play a role in hepatic inflammation in both sexes and liver steatosis in males.
16043761 Skeletal musscle expression is independently and inversely correlated with measures of central obesity.
16023994 AdipoR1 protein is neither altered by RXR or LXR agonists nor by pioglitazone. In contrast, fenofibric acid reduces AdipoR1 whereas hepatotoxic troglitazone upregulates AdipoR1 protein in HepG2 cells.
15983228 Observational study of gene-disease association. (HuGE Navigator)
15983228 Evidence for association between variation in the adiponectin receptor 1 and type 2 diabetes among Amish.
15918014 Observational study of gene-disease association. (HuGE Navigator)
15918014 Genetic variations in ADIPOR1 are unlikely to lead to a common genetic predisposition to insulin resistance or type 2 diabetes in the Japanese population.
15757860 Plasma adiponection and adiponectin receptor 1 and 2 mRNA expression in muscle are not acutely regulated by adipose tissue lipolysis and/or plasma FFA. Adiponectin is abundantly expressed in muscle and is present in/on sarcolemma of muscle fibres.
15454091 a link between adiponectin and bone homeostasis by demonstrating transcription, translation, and secretion of adiponectin, as well as expression of its receptors, AdipoR1 and AdipoR2, in bone-forming cells
15331527 myotube mRNA levels of both receptors are associated with distinct metabolic functions but not with insulin sensitivity; AdipoR1, but not AdipoR2, expression correlated with insulin secretion.
15277397 ADIPOR1 mRNA levels were significantly lower among transformed lymphocytes from diabetic African-American individuals than among control cell lines.
15105989 Epression levels of AdipoR1 as well as plasma adiponectin concentration were lower in people with a family history of Type 2.
14651988 Here we report the marked expression of mRNAs for the adiponectin receptors AdipoR1 and AdipoR2 in human and rat pancreatic beta cells, at levels similar to liver and greater than muscle.
12802337 cloning of cDNAs encoding adiponectin receptors 1 and 2 (AdipoR1 and AdipoR2) by expression cloning [AdipoR1 & AdipoR2]

AA Sequence

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLP      1 - 70
LQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWT     71 - 140
HLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYS    141 - 210
GIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVV    211 - 280
PTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFV    281 - 350
HFYGVSNLQEFRYGLEGGCTDDTLL                                                 351 - 375
//

Text Mined References (191)

PMID Year Title
26741812 2016 Analysis of the Relationship Between ADIPOR1 Variants and the Susceptibility of Chronic Metabolic Diseases in a Northeast Han Chinese Population.
26631404 2016 Downregulation of adiponectin system in granulosa cells and low levels of HMW adiponectin in PCOS.
26459399 2016 in vitro Anti-Proliferative Effect of Adiponectin on Human Endometriotic Stromal Cells through AdipoR1 and AdipoR2 Gene Receptor Expression.
26160610 2015 MiR-323 Inhibits Prostate Cancer Vascularization Through Adiponectin Receptor.
26146630 2015 Expression of Adiponectin Receptors on Peripheral Blood Leukocytes of Hypertensive Children Is Associated with the Severity of Hypertension.
26111083 2015 Polymorphisms in adiponectin receptor genes are associated with lipodystrophy-related phenotypes in HIV-infected patients receiving antiretroviral therapy.
26047008 2015 Three ADIPOR1 Polymorphisms and Cancer Risk: A Meta-Analysis of Case-Control Studies.
25892445 2015 Characterisation of the adiponectin receptors: Differential cell-surface expression and temporal signalling profiles of AdipoR1 and AdipoR2 are regulated by the non-conserved N-terminal trunks.
25855295 2015 Crystal structures of the human adiponectin receptors.
25640382 2015 Adipo-R1 and adipo-R2 expression in colorectal adenomas and carcinomas.
25586350 2015 Adiponectin inhibits VEGF-A in prostate cancer cells.
25582653 2015 Are decreased AdipoR1 mRNA levels associated with adiponectin resistance in coronary artery disease patients?
25575462 2015 Expression, purification, crystallization, and preliminary X-ray crystallographic studies of the human adiponectin receptors, AdipoR1 and AdipoR2.
25516230 2014 Associations between variants on ADIPOQ and ADIPOR1 with colorectal cancer risk: a Chinese case-control study and updated meta-analysis.
25475722 2015 Adiponectin signals through Adiponectin Receptor 1 to reverse imatinib resistance in K562 human chronic myeloid leukemia cells.
25392268 2015 Macrophage polarization phenotype regulates adiponectin receptor expression and adiponectin anti-inflammatory response.
25292021 2014 Adiponectin receptor 1 (ADIPOR1) rs1342387 polymorphism and risk of cancer: a meta-analysis.
25261236 2014 Adiponectin receptor signaling on dendritic cells blunts antitumor immunity.
25126860 2014 Regulation of insulin sensitivity by adiponectin and its receptors in response to physical exercise.
25049200 2014 Adiponectin receptor and adiponectin signaling in human tissue among patients with end-stage renal disease.
24969908 2014 Lack of any prognostic relationship between adiponectin receptor (Adipo R1/R2) expression for early/advanced stage gastric cancer.
24967709 2014 Identification of susceptibility variants in ADIPOR1 gene associated with type 2 diabetes, coronary artery disease and the comorbidity of type 2 diabetes and coronary artery disease.
24888493 2014 Down-regulation of adiponectin receptors in osteoarthritic chondrocytes.
24673523 2014 Differential effects of adiponectin in osteoblast-like cells.
24619866 2014 Adiponectin receptor expression predicts favorable prognosis in cases of hepatocellular carcinoma.
24335000 2014 Association between adiponectin receptor 1 gene polymorphism and insulin resistance in Chinese patients with polycystic ovary syndrome.
24104889 2015 Disturbed adiponectin – AMPK system in skeletal muscle of patients with metabolic syndrome.
24096711 2014 Underactivation of the adiponectin-adiponectin receptor 1 axis in clear cell renal cell carcinoma: implications for progression.
23971629 2013 Adiponectin receptors are present in RANK-L-induced multinucleated osteoclast-like cells.
23922494 2013 Expression of adiponectin and its receptors in type 1 diabetes mellitus in human and mouse retinas.
23922112 2013 Clinical and genetic predictors of weight gain in patients diagnosed with breast cancer.
23860432 2013 Adiponectin receptor 1 C-terminus interacts with PDZ-domain proteins such as syntrophins.
23860143 Adiponectin receptor 1 expression is associated with carotid plaque stability.
23813974 2013 The large non-coding RNA ANRIL, which is associated with atherosclerosis, periodontitis and several forms of cancer, regulates ADIPOR1, VAMP3 and C11ORF10.
23776679 2013 miR-221/222 targets adiponectin receptor 1 to promote the epithelial-to-mesenchymal transition in breast cancer.
23756394 2013 Adiponectin and leptin receptors expression in Barrett's esophagus and normal squamous epithelium in relation to central obesity status.
23656997 Single-nucleotide polymorphisms in adiponectin, AdipoR1, and AdipoR2 genes: insulin resistance and type 2 diabetes mellitus candidate genes.
23500159 2013 Adiponectin affects lung epithelial A549 cell viability counteracting TNF? and IL-1ß toxicity through AdipoR1.
23388528 2013 [Fat distribution and its relationship with genetic polymorphism in patients with nonalcoholic liver disease].
23386639 2013 Inhibition of islet immunoreactivity by adiponectin is attenuated in human type 1 diabetes.
23358721 2013 Adiponectin receptor expression in gastric carcinoma: implications in tumor development and progression.
23358237 2013 Expression of adiponectin receptor 1 is indicative of favorable prognosis in non-small cell lung carcinoma.
23355630 2013 Molecular pathways: adiponectin and leptin signaling in cancer.
23351195 2013 A comprehensive investigation of variants in genes encoding adiponectin (ADIPOQ) and its receptors (ADIPOR1/R2), and their association with serum adiponectin, type 2 diabetes, insulin resistance and the metabolic syndrome.
23293232 2012 [Relationship gene polymorphism adipor1 with cardiovascular risk in patients with nonalcoholic fatty liver disease].
23255609 2013 Adiponectin receptors form homomers and heteromers exhibiting distinct ligand binding and intracellular signaling properties.
22907586 2013 Expression and biologic significance of adiponectin receptors in papillary thyroid carcinoma.
22842631 2012 Globular adiponectin inhibits ethanol-induced apoptosis in HepG2 cells through heme oxygenase-1 induction.
22767440 2013 No conclusive evidence for association of polymorphisms in the adiponectin receptor 1 gene, AdipoR1, with common obesity.
22633650 2012 Adiponectin and its receptors modulate granulosa cell and cumulus cell functions, fertility, and early embryo development in the mouse and human.
22534793 2012 Arterial stiffness is associated with increased monocyte expression of adiponectin receptor mRNA and protein in patients with coronary artery disease.
22495003 2012 Association of ADIPOR1 polymorphisms with bone mineral density in postmenopausal Korean women.
22387454 2012 Adiponectin receptor 1 gene (ADIPOR1) variant is associated with advanced age-related macular degeneration in Finnish population.
22340319 2011 Adiponectin receptor 1 mediates the difference in adiponectin- induced prostaglandin E2 production in rheumatoid arthritis and osteoarthritis synovial fibroblasts.
22265003 2012 Adiponectin and leptin systems in human endometrium during window of implantation.
22227293 2012 Adiponectin-AdipoR1/2-APPL1 signaling axis suppresses human foam cell formation: differential ability of AdipoR1 and AdipoR2 to regulate inflammatory cytokine responses.
22186245 The expression of adiponectin receptor is altered in mild and moderate/severe persistent allergic nasal mucosa.
22106445 2012 HTR1B, ADIPOR1, PPARGC1A, and CYP19A1 and obesity in a cohort of Caucasians and African Americans: an evaluation of gene-environment interactions and candidate genes.
22087284 2011 Interactions between genetic variants in the adiponectin, adiponectin receptor 1 and environmental factors on the risk of colorectal cancer.
22082804 2012 Aberrant expressions of leptin and adiponectin receptor isoforms in chronic myeloid leukemia patients.
22078265 2011 Adiponectin receptor-1 expression is associated with good prognosis in gastric cancer.
22050309 2012 The therapeutic potential of the adiponectin pathway.
22049178 2012 Variants of the adiponectin and adiponectin receptor-1 genes and posttransplantation diabetes mellitus in renal allograft recipients.
21980131 2011 Direct role of adiponectin and adiponectin receptors in endometrial cancer: in vitro and ex vivo studies in humans.
21960694 2011 Common polymorphisms in the adiponectin and its receptor genes, adiponectin levels and the risk of prostate cancer.
21900123 2011 Globular adiponectin counteracts VCAM-1-mediated monocyte adhesion via AdipoR1/NF-?B/COX-2 signaling in human aortic endothelial cells.
21761356 2010 Adiponectin receptor expression in human malignant tissues.
21750988 2011 Adiponectin receptor 1 interacts with both subunits of protein kinase CK2.
21749709 2011 Effects of genetic variations in the adiponectin pathway genes on the risk of colorectal cancer in the Chinese population.
21632074 2011 Serum adiponectin levels and tissue expression of adiponectin receptors are associated with risk, stage, and grade of colorectal cancer.
21538348 2011 Adiponectin is a negative regulator of antigen-activated T cells.
21397927 2011 Polymorphisms of ADIPOQ and ADIPOR1 and prostate cancer risk.
21351255 2010 Adiponectin and adiponectin receptor in relation to colorectal cancer progression.
21331343 2011 The myocyte expression of adiponectin receptors and PPAR? is highly coordinated and reflects lipid metabolism of the human donors.
21321996 2011 Adiponectin increases MMP-3 expression in human chondrocytes through AdipoR1 signaling pathway.
21289205 2011 Differential expression of novel adiponectin receptor-1 transcripts in skeletal muscle of subjects with normal glucose tolerance and type 2 diabetes.
21284833 2011 Adiponectin levels and expression of adiponectin receptors in isolated monocytes from overweight patients with coronary artery disease.
21273992 2011 ADIPOQ, ADIPOR1, and ADIPOR2 polymorphisms in relation to serum adiponectin levels and BMI in black and white women.
21195057 2011 Adiponectin inhibits lymphotoxin-? receptor-mediated NF-?B signaling in human umbilical vein endothelial cells.
20952631 2010 Association of single-nucleotide polymorphisms from 17 candidate genes with baseline symptom-limited exercise test duration and decrease in duration over 20 years: the Coronary Artery Risk Development in Young Adults (CARDIA) fitness study.
20938443 2011 A polymorphism in the gene encoding AdipoR1 affects olfactory recognition.
20875820 2010 Adiponectin receptor binding proteins--recent advances in elucidating adiponectin signalling pathways.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20697428 2010 Genetic variation in adiponectin (ADIPOQ) and the type 1 receptor (ADIPOR1), obesity and prostate cancer in African Americans.
20696134 2010 ATF3 negatively regulates adiponectin receptor 1 expression.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20470935 2010 Low-abundant adiponectin receptors in visceral adipose tissue of humans and rats are further reduced in diabetic animals.
20432444 2010 Adiponectin increases BMP-2 expression in osteoblasts via AdipoR receptor signaling pathway.
20336470 2010 Adiponectin receptors are downregulated in human gastric cancer.
20332107 2010 Dimerization of adiponectin receptor 1 is inhibited by adiponectin.
20129487 2010 Sex difference in cardiometabolic risk profile and adiponectin expression in subjects with visceral fat obesity.
20125105 2010 Hepatic adiponectin receptors (ADIPOR) 1 and 2 mRNA and their relation to insulin resistance in obese humans.
20120899 Association of single nucleotide polymorphisms in adiponectin and its receptor genes with polycystic ovary syndrome.
20074551 2010 ERp46 binds to AdipoR1, but not AdipoR2, and modulates adiponectin signalling.
20071013 2010 Impact of AdipoR1 expression on breast cancer development.
20059631 2010 A multilocus candidate approach identifies ACE and HIF1A as susceptibility genes for cellulite.
20032495 2010 Gene-nutrient interactions in the metabolic syndrome: single nucleotide polymorphisms in ADIPOQ and ADIPOR1 interact with plasma saturated fatty acids to modulate insulin resistance.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19909601 2009 Omental fat expression of adiponectin and adiponectin receptors in non-obese women with PCOS: a preliminary study.
19887569 2010 Circadian expression of adiponectin and its receptors in human adipose tissue.
19727342 2009 Gene expression in the mouse eye: an online resource for genetics using 103 strains of mice.
19723917 2009 No association between polymorphisms in LEP, LEPR, ADIPOQ, ADIPOR1, or ADIPOR2 and postmenopausal breast cancer risk.
19672024 2009 Adiponectin and adiponectin receptors in human pheochromocytoma.
19671624 2009 Role of adiponectin receptors, AdipoR1 and AdipoR2, in the steroidogenesis of the human granulosa tumor cell line, KGN.
19631916 2009 Association study of the single nucleotide polymorphisms in adiponectin-associated genes with type 2 diabetes in Han Chinese.
19549705 2009 Involvement of AdipoR receptor in adiponectin-induced motility and alpha2beta1 integrin upregulation in human chondrosarcoma cells.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19524379 2009 Influence of insulin resistance on adiponectin receptor expression in breast cancer.
19487733 2009 Expressions of adiponectin receptors in placenta and their correlation with preeclampsia.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19233263 2009 Protein kinase CK2 interacts with adiponectin receptor 1 and participates in adiponectin signaling.
19208777 2009 Genetic variation in the ADIPOR2 gene is associated with liver fat content and its surrogate markers in three independent cohorts.
19196212 2009 Adiponectin induced placental cell apoptosis could be mediated via the ADIPOR1-receptor in pre-eclampsia with IUGR.
19144434 2009 The relationship between -8503G/A polymorphism of adiponectin receptor 1 and insulin sensitivity in the Japanese population.
19120283 2008 The distribution of adiponectin receptors on human peripheral blood mononuclear cells.
19109202 2009 Adiponectin and functional adiponectin receptor 1 are expressed by airway epithelial cells in chronic obstructive pulmonary disease.
19051043 2009 Pancreatic cancer expresses adiponectin receptors and is associated with hypoleptinemia and hyperadiponectinemia: a case-control study.
19037660 2009 The association of SNPs in ADIPOQ, ADIPOR1, and ADIPOR2 with insulin sensitivity in a cohort of adolescents and their parents.
19010305 2009 Receptor for activated C-kinase 1, a novel binding partner of adiponectin receptor 1.
18996753 Response of adiponectin and its receptors to changes in metabolic state after gastric bypass surgery: dissociation between adipose tissue expression and circulating levels.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18988888 2009 Overexpression of adiponectin receptors potentiates the antiinflammatory action of subeffective dose of globular adiponectin in vascular endothelial cells.
18982021 2009 Endocytosis of adiponectin receptor 1 through a clathrin- and Rab5-dependent pathway.
18923878 2009 Pattern of expression of adiponectin receptors in human liver and its relation to nonalcoholic steatohepatitis.
18854016 2008 Diabetes-specific genetic effects on obesity traits in American Indian populations: the Strong Heart Family Study.
18842004 2008 The adiponectin receptors AdipoR1 and AdipoR2 activate ERK1/2 through a Src/Ras-dependent pathway and stimulate cell growth.
18827209 2008 Variants of the adiponectin (ADIPOQ) and adiponectin receptor 1 (ADIPOR1) genes and colorectal cancer risk.
18719649 2008 Association of ADIPOR2 with liver function tests in type 2 diabetic subjects.
18713296 2009 Expression of adiponectin and its receptors in livers of morbidly obese patients with non-alcoholic fatty liver disease.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18622492 2008 Association of polymorphisms at the ADIPOR1 regulatory region with type 2 diabetes and body mass index in a Brazilian population with European or African ancestry.
18599322 A single nucleotide polymorphism alters the sequence of SP1 binding site in the adiponectin promoter region and is associated with diabetic nephropathy among type 1 diabetic patients in the Genetics of Kidneys in Diabetes Study.
18548168 2008 Adiponectin and adiponectin receptor gene variants in relation to type 2 diabetes and insulin resistance-related phenotypes.
18466348 2009 Polymorphisms of ADIPOR1 and ADIPOR2 are associated with phenotypes of type 2 diabetes in Koreans.
18451143 2008 Variants of the adiponectin and adiponectin receptor 1 genes and breast cancer risk.
18313838 2008 Globular adiponectin, acting via adiponectin receptor-1, inhibits leptin-stimulated oesophageal adenocarcinoma cell proliferation.
18310295 2008 Adiponectin receptor expression is elevated in colorectal carcinomas but not in gastrointestinal stromal tumors.
18294218 2008 Associations between glucose tolerance, insulin sensitivity and insulin secretion phenotypes and polymorphisms in adiponectin and adiponectin receptor genes in the Quebec Family Study.
18163210 2008 Growth-inhibitory effect of adiponectin via adiponectin receptor 1 on human breast cancer cells through inhibition of S-phase entry without inducing apoptosis.
18097620 2008 Association of polymorphisms of ABCA1 and ROS1 with hypertension in Japanese individuals.
17911635 2007 Adiponectin enhances IL-6 production in human synovial fibroblast via an AdipoR1 receptor, AMPK, p38, and NF-kappa B pathway.
17878241 2007 Gene expression of adiponectin receptors in human visceral and subcutaneous adipose tissue is related to insulin resistance and metabolic parameters and is altered in response to physical training.
17716299 2007 Polymorphisms in adiponectin receptor genes ADIPOR1 and ADIPOR2 and insulin resistance.
17712104 2007 Adiponectin receptor 1 variants associated with lower insulin resistance in African Americans.
17697862 2007 The effect of renal transplantation on adiponectin and its isoforms and receptors.
17459059 2007 Adiponectin inhibits the growth and peritoneal metastasis of gastric cancer through its specific membrane receptors AdipoR1 and AdipoR2.
17426101 2007 Relationships of plasma adiponectin level and adiponectin receptors 1 and 2 gene expression to insulin sensitivity and glucose and fat metabolism in monozygotic and dizygotic twins.
17416799 2007 Variations in adiponectin receptor genes and susceptibility to type 2 diabetes in women: a tagging-single nucleotide polymorphism haplotype analysis.
17285539 2007 [Relationship between adiponectin receptor 1 gene -3881T/C variant and glucose metabolism in the Chinese].
17216283 2007 Adiponectin receptor genes: mutation screening in syndromes of insulin resistance and association studies for type 2 diabetes and metabolic traits in UK populations.
17209173 2007 Adiponectin and adiponectin receptor gene variants in relation to resting metabolic rate, respiratory quotient, and adiposity-related phenotypes in the Quebec Family Study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17123704 2007 Demonstration of adiponectin receptors 1 and 2 mRNA expression in human breast cancer cells.
17118803 2006 Localization of novel adiponectin receptor constructs.
17054465 2006 Identification of adiponectin and its receptors in human osteoblast-like cells and association of T45G polymorphism in exon 2 of adiponectin gene with lumbar spine bone mineral density in Korean women.
17006986 2006 Adiponectin and its receptors in rodent models of fatty liver disease and liver cirrhosis.
17003341 2006 Common haplotypes at the adiponectin receptor 1 (ADIPOR1) locus are associated with increased risk of coronary artery disease in type 2 diabetes.
17001470 2006 Upregulation of adiponectin receptor 1 and 2 mRNA and protein in adipose tissue and adipocytes in insulin-resistant women with polycystic ovary syndrome.
16955209 2006 Association between variants in the genes for adiponectin and its receptors with insulin resistance syndrome (IRS)-related phenotypes in Mexican Americans.
16899222 2006 The regulation of adiponectin receptors in human prostate cancer cell lines.
16793963 2006 Increased adiponectin receptor-1 expression in adipose tissue of impaired glucose-tolerant obese subjects during weight loss.
16724230 2006 Association of sequence variations in the gene encoding adiponectin receptor 1 (ADIPOR1) with body size and insulin levels. The Finnish Diabetes Prevention Study.
16700915 2006 Genetic variants of adiponectin receptor 2 are associated with increased adiponectin levels and decreased triglyceride/VLDL levels in patients with metabolic syndrome.
16678125 2006 Adiponectin mediates antiproliferative and apoptotic responses in human MCF7 breast cancer cells.
16622416 2006 APPL1 binds to adiponectin receptors and mediates adiponectin signalling and function.
16609881 2006 Regulation of adiponectin receptors in hepatocytes by the peroxisome proliferator-activated receptor-gamma agonist rosiglitazone.
16601138 2006 Expression of adiponectin receptors and its possible implication in the human endometrium.
16505255 2006 Genetic analysis of ADIPOR1 and ADIPOR2 candidate polymorphisms for type 2 diabetes in the Caucasian population.
16443913 2006 The -8503 G/A polymorphism of the adiponectin receptor 1 gene is associated with insulin sensitivity dependent on adiposity.
16205883 2005 Polymorphisms in the gene encoding adiponectin receptor 1 are associated with insulin resistance and high liver fat.
16139921 2005 Adiponectin and its receptors in patients with chronic hepatitis C.
16044242 2005 PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif.
16043761 2005 Expression of AdipoR1 in vivo in skeletal muscle is independently associated with measures of truncal obesity in middle-aged caucasian men.
16023994 2005 Regulation of adiponectin receptor 1 in human hepatocytes by agonists of nuclear receptors.
15983228 2005 Genetic variation in adiponectin receptor 1 and adiponectin receptor 2 is associated with type 2 diabetes in the Old Order Amish.
15918014 2005 Absence of an association between the polymorphisms in the genes encoding adiponectin receptors and type 2 diabetes.
15757860 2005 The effects of exercise and adipose tissue lipolysis on plasma adiponectin concentration and adiponectin receptor expression in human skeletal muscle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454091 2004 Adiponectin and its receptors are expressed in bone-forming cells.
15331527 2004 Expression of adiponectin receptor mRNA in human skeletal muscle cells is related to in vivo parameters of glucose and lipid metabolism.
15277397 2004 Adiponectin receptor 1 gene (ADIPOR1) as a candidate for type 2 diabetes and insulin resistance.
15105989 2004 Adiponectin receptors gene expression and insulin sensitivity in non-diabetic Mexican Americans with or without a family history of Type 2 diabetes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14651988 2003 Expression of adiponectin receptors in pancreatic beta cells.
12802337 2003 Cloning of adiponectin receptors that mediate antidiabetic metabolic effects.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.