Property Summary

NCBI Gene PubMed Count 19
PubMed Score 96.62
PubTator Score 101.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.244 1.7e-03
osteosarcoma -1.803 5.4e-06
group 4 medulloblastoma -1.700 4.1e-05
pancreatic ductal adenocarcinoma liver m... -2.746 9.0e-04
subependymal giant cell astrocytoma 1.442 1.6e-02
gastric carcinoma -1.300 2.0e-02
ovarian cancer 1.600 9.6e-03
pancreatic cancer 1.300 1.3e-03

Gene RIF (6)

PMID Text
25640948 Data elucidate a new role for MTCBP-1 regulating the intracellular function of MT1-MMP-mediated autophagy. Their inverse expression correlation with brain tumor grades could also contribute to the decreased autophagic index observed in high-grade tumors.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19626614 293-ADI1-CD81 cells are permissive for serum-derived HCV infection.
17786183 ADI1 may check prostate cancer progression through apoptosis by an activity that does not require metal binding.
17212658 nucleo-cytoplasmic transport of hADI1 is regulated by a non-canonical nuclear export signal (NES) located in the N-terminal region of hADI1.
14718544 MTCBP-1 is a new member of the Cupin superfamily with a role as an invasion suppressor down-regulated in tumors

AA Sequence

MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITIC      1 - 70
KDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEK     71 - 140
NYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA                                   141 - 179
//

Text Mined References (22)

PMID Year Title
25640948 2016 Evidence of MTCBP-1 interaction with the cytoplasmic domain of MT1-MMP: Implications in the autophagy cell index of high-grade glioblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19626614 2009 293 cells over-expressing human ADI1 and CD81 are permissive for serum-derived hepatitis C virus infection.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17786183 2007 Expression and function of the human androgen-responsive gene ADI1 in prostate cancer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17212658 2007 Regulated nucleo-cytoplasmic shuttling of human aci-reductone dioxygenase (hADI1) and its potential role in mRNA processing.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15938715 2005 Membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1 (MTCBP-1) acts as an eukaryotic aci-reductone dioxygenase (ARD) in the methionine salvage pathway.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14718544 2004 Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein-1 is a new member of the Cupin superfamily. A possible multifunctional protein acting as an invasion suppressor down-regulated in tumors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11602742 2001 Identification of a hepatic factor capable of supporting hepatitis C virus replication in a nonpermissive cell line.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.