Property Summary

NCBI Gene PubMed Count 23
PubMed Score 69.29
PubTator Score 17.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
nephrosclerosis -1.690 2.3e-02
pancreatic ductal adenocarcinoma liver m... -1.326 1.4e-02
colon cancer -1.800 4.6e-02
ulcerative colitis -1.400 2.4e-04
chronic rhinosinusitis -1.639 1.5e-02
cystic fibrosis and chronic rhinosinusit... -1.319 4.9e-02
psoriasis -1.500 3.8e-30

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (7)

PMID Text
23468174 common ADH variants conferred risk for both schizophrenia in African-Americans and autism in European-Americans.
22690706 Results show that polymorphism of ADH6 gene leads to heavy drinking in women.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
17185388 Observational study of gene-disease association. (HuGE Navigator)
16685648 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHE      1 - 70
GAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYH     71 - 140
FGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTGFGAAINTAKVTPGSTCAVFGLGGVGLSVVM    141 - 210
GCKAAGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAAL    211 - 280
ASCNESYGVCVVVGVLPASVQLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHT    281 - 350
LNLDKINEAVELMKTGKW                                                        351 - 368
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23468174 2013 Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.
23456092 2013 Extended genetic effects of ADH cluster genes on the risk of alcohol dependence: from GWAS to replication.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22690706 2012 Association of alcohol dehydrogenase polymorphisms and life-style factors with excessive alcohol intake within the Spanish population (EPIC-Spain).
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19698717 2009 Functional variants in ADH1B and ALDH2 coupled with alcohol and smoking synergistically enhance esophageal cancer risk.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17185388 2007 Multiple ADH genes modulate risk for drug dependence in both African- and European-Americans.
16685648 2006 Diplotype trend regression analysis of the ADH gene cluster and the ALDH2 gene: multiple significant associations with alcohol dependence.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12050823 2002 A global perspective on genetic variation at the ADH genes reveals unusual patterns of linkage disequilibrium and diversity.
11095947 2000 Human class V alcohol dehydrogenase (ADH5): A complex transcription unit generates C-terminal multiplicity.
10975466 2000 Tissue-specific regulatory elements in the human alcohol dehydrogenase 6 gene.
7695785 1994 Genetic polymorphisms of alcohol metabolizing enzymes related to alcohol sensitivity and alcoholic diseases.
2198032 1990 Interaction of ethanol with drugs, hepatotoxic agents, carcinogens and vitamins.
1881901 1991 A human alcohol dehydrogenase gene (ADH6) encoding an additional class of isozyme.
1755855 1991 Enzymatic properties of the protein encoded by newly cloned human alcohol dehydrogenase ADH6 gene.
1593644 1992 Progressive sequence alignment and molecular evolution of the Zn-containing alcohol dehydrogenase family.
9982 1976 Human liver alcohol dehydrogenase: purification, composition, and catalytic features.