Property Summary

NCBI Gene PubMed Count 59
PubMed Score 216.12
PubTator Score 213.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (30)

PMID Text
26491229 GSNOR expression has different effect on neuronal viability in dependence on the stimulus applied, and plays opposite roles in SH-SY5Y models of Parkinson's disease and amyotrophic lateral sclerosis
24895131 ADH5 counteracts neuronal differentiation of neural stem cells and this effect can be reversed by pharmacological inhibition of ADH5.
23468174 common ADH variants conferred risk for both schizophrenia in African-Americans and autism in European-Americans.
23355119 study compared individuals occupationally exposed to formaldehyde and controls to effects of XRCC3 Thr241Met, ADH5 Val309Ile and Asp353Glu polymorphisms; ADH5 polymorphisms did not show significant association with genotoxicity biomarkers
23285246 A decrease in ADH IB, rather than GSNOR, correlates with human lung cancer.
22335564 N6022 binds in the GSNO binding pocket like a competitive inhibitor, although in kinetic assays it behaves with a mixed uncompetitive mode of inhibition (MOI) toward GSNO and a mixed competitive MOI toward formaldehyde adduct S-hydroxymethylglutathione.
21920416 biological significance of SNPs rs11568816, rs17028487 and rs13832
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20371487 Data suggest that GSNOR deficiency, through dysregulated S-nitrosylation, may promote hepatocellular carcinoma, possibly by inactivating a DNA repair system.
20335826 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20158305 Significant associations were found however, for reactions to alcohol with a SNP in ADH5 (rs6827292, p = .001) and a SNP just upstream of ADH5 (rs6819724, p = .0007) that is in strong LD with rs6827292.
19898482 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19596685 GSNOR inhibitors to be novel tools for regulating nitric oxide bioactivity and assessing the role of SNOs in vivo.
19514054 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18996923 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18331377 Observational study of gene-disease association. (HuGE Navigator)
18095160 A statistically significant increase of class III alcohol dehydrogenase isoenzymes was found in the sera of pancreatic cancer patients.
17543375 Observational study of gene-disease association. (HuGE Navigator)
17543375 data suggest that genetic variation in S-nitrosoglutathione reductase (GSNOR) might play a role in asthma susceptibility
17185388 Observational study of gene-disease association. (HuGE Navigator)
16685648 Observational study of gene-disease association. (HuGE Navigator)
14608084 No evidence that alcohol dehydrogenase 3genotype modifies risk related to alcohol and lung cancer.
12484756 Formation of a FDH-S-(hydroxymethyl)glutathione-NADH ternary complex causes movement of glutathione-dependent formaldehyde dehydrogenase catalytic domain toward the coenzyme-binding domain, and a change in active-site zinc coordination.
12196016 The structural determination of apo, binary alcohol, and inhibitory ternary FDH complexes provides new insight into the enzyme's metal-assisted catalysis and substrate-binding properties.
12004059 POZ domain of FBI1 represses transcription of ADH5.

AA Sequence

MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGA      1 - 70
GIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHY     71 - 140
MGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMG    141 - 210
CKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALE    211 - 280
ACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNL    281 - 350
SFDEINKAFELMHSGKSIRTVVKI                                                  351 - 374
//

Text Mined References (63)

PMID Year Title
26491229 2015 S-Nitrosoglutathione Reductase Plays Opposite Roles in SH-SY5Y Models of Parkinson's Disease and Amyotrophic Lateral Sclerosis.
24895131 2014 A novel suppressive effect of alcohol dehydrogenase 5 in neuronal differentiation.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23468174 2013 Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.
23456092 2013 Extended genetic effects of ADH cluster genes on the risk of alcohol dependence: from GWAS to replication.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23355119 2013 The influence of genetic polymorphisms in XRCC3 and ADH5 genes on the frequency of genotoxicity biomarkers in workers exposed to formaldehyde.
23285246 2012 ADH IB expression, but not ADH III, is decreased in human lung cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22335564 2012 Mechanism of inhibition for N6022, a first-in-class drug targeting S-nitrosoglutathione reductase.
21920416 2011 Genetic polymorphisms in the formaldehyde dehydrogenase gene and their biological significance.
21269460 2011 Initial characterization of the human central proteome.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20371487 2010 S-nitrosylation from GSNOR deficiency impairs DNA repair and promotes hepatocarcinogenesis.
20335826 2010 GSNO reductase and beta2-adrenergic receptor gene-gene interaction: bronchodilator responsiveness to albuterol.
20158305 2010 Associations between ADH gene variants and alcohol phenotypes in Dutch adults.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19596685 2009 Kinetic and cellular characterization of novel inhibitors of S-nitrosoglutathione reductase.
19514054 2009 Genetic variants of GSNOR and ADRB2 influence response to albuterol in African-American children with severe asthma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18996923 2009 Associations of ADH and ALDH2 gene variation with self report alcohol reactions, consumption and dependence: an integrated analysis.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18331377 2008 Association of ADH and ALDH genes with alcohol dependence in the Irish Affected Sib Pair Study of alcohol dependence (IASPSAD) sample.
18095160 2008 Alcohol dehydrogenase (ADH) isoenzymes and aldehyde dehydrogenase (ALDH) activity in the sera of patients with pancreatic cancer.
17543375 2007 Genetic variation in S-nitrosoglutathione reductase (GSNOR) and childhood asthma.
17185388 2007 Multiple ADH genes modulate risk for drug dependence in both African- and European-Americans.
16685648 2006 Diplotype trend regression analysis of the ADH gene cluster and the ALDH2 gene: multiple significant associations with alcohol dependence.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14608084 2003 Lung cancer in humans is not associated with lifetime total alcohol consumption or with genetic variation in alcohol dehydrogenase 3 (ADH3).
12484756 2002 Human glutathione-dependent formaldehyde dehydrogenase. Structural changes associated with ternary complex formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12196016 2002 Human glutathione-dependent formaldehyde dehydrogenase. Structures of apo, binary, and inhibitory ternary complexes.
12141816 2002 Activity of class I, II, III, and IV alcohol dehydrogenase isoenzymes in human gastric mucosa.
12004059 2002 POZ domain transcription factor, FBI-1, represses transcription of ADH5/FDH by interacting with the zinc finger and interfering with DNA binding activity of Sp1.
11368338 2001 Posttranscriptional regulation of human ADH5/FDH and Myf6 gene expression by upstream AUG codons.
10978156 2000 Kinetic mechanism of human glutathione-dependent formaldehyde dehydrogenase.
10661511 2000 Histological distribution of class III alcohol dehydrogenase in human brain.
9018047 1997 Structure of human chi chi alcohol dehydrogenase: a glutathione-dependent formaldehyde dehydrogenase.
8503936 1993 Extrahepatic, differential expression of four classes of human alcohol dehydrogenase.
8494891 1993 Role of arginine 115 in fatty acid activation and formaldehyde dehydrogenase activity of human class III alcohol dehydrogenase.
8460164 1993 Mutation of Arg-115 of human class III alcohol dehydrogenase: a binding site required for formaldehyde dehydrogenase activity and fatty acid activation.
7948423 1994 [Immunoenzyme and immunohistochemical analysis of class III alcohol dehydrogenase from human testis].
6424546 1984 Immunological and biochemical characterization of the human alcohol dehydrogenase chi-ADH isozyme.
6375718 1984 Physical and enzymatic properties of a class III isozyme of human liver alcohol dehydrogenase: chi-ADH.
3365377 1988 Class III human liver alcohol dehydrogenase: a novel structural type equidistantly related to the class I and class II enzymes.
2936344 1986 Organ-specific human alcohol dehydrogenase: isolation and characterization of isozymes from testis.
2934732 1985 chi-ADH is the sole alcohol dehydrogenase isozyme of mammalian brains: implications and inferences.
2818582 1989 cDNA sequence of human class III alcohol dehydrogenase.
2679557 1989 Cloning and comparative mapping of a human class III (chi) alcohol dehydrogenase cDNA.
1577708 1992 Abnormal fractionation of beta-lactamase in Escherichia coli: evidence for an interaction with the inner membrane in the absence of a leader peptide.
1453005 1992 Immunocytochemical and biochemical demonstration of formaldhyde dehydrogenase (class III alcohol dehydrogenase) in the nucleus.
1446828 1992 Cloning and characterization of the ADH5 gene encoding human alcohol dehydrogenase 5, formaldehyde dehydrogenase.