Property Summary

NCBI Gene PubMed Count 54
PubMed Score 242.32
PubTator Score 59.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.258 1.0e-02

Protein-protein Interaction (6)

Gene RIF (44)

PMID Text
26039424 this current study provides substantial evidence that genetic polymorphisms of rs3805322 in the ADH4 gene may be associated with an increased risk of developing ESCC in two Chinese Han populations.
24469609 This study confirmed the genetic heterogeneity of cluster headache, suggesting that mutations in the ADH4 gene might be related to cluster headache in a subset of cases.
24051444 The serum expression of ADH4 protein correlates with the progression of esophageal cancer.
23468174 common ADH variants conferred risk for both schizophrenia in African-Americans and autism in European-Americans.
22232963 Our results suggest that the analysed polymorphisms ofANKK1 and ADH4 can play an important part in the pathogenesis of alcohol abuse
22147505 expression levels of ADH4 mRNA and protein have found to be markedly reduced in hepatocellular carcinoma (HCC) tissues and significantly associated with survival.
22044940 data suggest that ADH4 intronic variants play a role in alcohol dependence susceptibility in Italian populations
21635275 Variants in the ADH1B and ADH4 genes may be protective against the development of some symptoms associated with alcohol dependence.
21480392 Data indicate that further studies of EPHX1 rs1051740, ADH4 r1042364, and NQO1 rs291766 are needed to make more definitive conclusion on the role of variation in xenobiotic metabolism in ovarian cancer.
21184752 the high catalytic activity of human alcohol dehydrogenase 4 studied with horse liver ADH1E
20800603 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20626721 This study confirms the significant relationship of ADH4 variants with AD and related phenotypes.
20626721 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20363298 In this study we have identified a distal upstream enhancer, 4E, of ADH4. In HepG2 human hepatoma cells, 4E increased the activity of an ADH4 basal promoter by 50-fold. 4E was cell-specific.
19925625 Our data suggest that cluster headache is associated with the ADH4 gene or a linked locus. Additional studies are warranted to elucidate the role of this gene in the etiopathogenesis of the disease.
19925625 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19861527 ADH4 gene polymorphisms are associated with upper aerodigestive tract cancers.
19861527 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19687126 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19193628 Observational study of gene-disease association. (HuGE Navigator)
19182438 Class II alcohol dehydogenase (ADH4) is considered to contribute to ethanol oxidation in the liver at high concentration.
19182438 Observational study of gene-disease association. (HuGE Navigator)
18996923 Observational study of gene-disease association. (HuGE Navigator)
18801187 Observational study of gene-disease association. (HuGE Navigator)
18331377 Observational study of gene-disease association. (HuGE Navigator)
17069770 Observational study of gene-disease association. (HuGE Navigator)
17069770 that personality traits and substance dependence have a partially overlapping genetic basis.
16237392 Observational study of gene-disease association. (HuGE Navigator)
16237392 Seven single nucleotide polymorphisms spanning the ADH4 gene were genotyped in 561 subjects affected with alcohol dependence and/or drug dependence.
16220108 Observational study of gene-disease association. (HuGE Navigator)
16220108 the genotypes of six ADH4 markers were associated with alcohol dependence, and all seven ADH4 markers were associated with drug dependence
15863808 Observational study of gene-disease association. (HuGE Navigator)
14745297 The mean alcohol-elimination rate among ADH2*2 carriers is significantly higher than among ADH2*1 homozygotes in a male Jewish population.
12631290 Results describe the expression patterns of alcohol dehydrogenases I, III, and IV in adult rat, mouse and human tissues using radioactive oligonucleotide in situ hybridization.
11997393 kinetic mechanisms for ADH4 functioning as retinol dehydrogenase
11964133 Identification and characterisation of two allelic forms of human alcohol dehydrogenase 2
11916005 Thirteen new single nucleotide polymorphisms
11900616 Observational study of gene-disease association. (HuGE Navigator)
11009184 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGTKGKVIKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIVGHE      1 - 70
AAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKG     71 - 140
KPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAKVTPGSTCAVFGLGGVG    141 - 210
LSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET    211 - 280
MKAALDCTTAGWGSCTFIGVAAGSKGLTIFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDA    281 - 350
LVTHTLPFDKISEAFDLMNQGKSVRTILIF                                            351 - 380
//

Text Mined References (57)

PMID Year Title
26039424 2015 Impact of alcohol dehydrogenase gene 4 polymorphisms on esophageal squamous cell carcinoma risk in a Chinese population.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24469609 2015 Molecular analysis of cluster headache.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24051444 2013 The alcohol dehydrogenase isoenzyme (ADH IV) as a candidate tumour marker of esophageal cancer.
23468174 2013 Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.
23456092 2013 Extended genetic effects of ADH cluster genes on the risk of alcohol dependence: from GWAS to replication.
22960999 2012 Genome-wide association analyses of esophageal squamous cell carcinoma in Chinese identify multiple susceptibility loci and gene-environment interactions.
22232963 [Research on associations between selected polymorphisms of genes DRD2, 5HTT, GRIK3, ADH4 and alcohol dependence syndrome].
22147505 2012 Identification of ADH4 as a novel and potential prognostic marker in hepatocellular carcinoma.
22044940 2012 ADH4 intronic variations are associated with alcohol dependence: results from an Italian case-control association study.
21635275 2011 Association of alcohol dehydrogenase genes with alcohol-related phenotypes in a Native American community sample.
21480392 2011 Xenobiotic-Metabolizing gene polymorphisms and ovarian cancer risk.
21184752 2011 Origins of the high catalytic activity of human alcohol dehydrogenase 4 studied with horse liver A317C alcohol dehydrogenase.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20626721 2011 Association of ADH4 genetic variants with alcohol dependence risk and related phenotypes: results from a larger multicenter association study.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20363298 2010 Identification of a FOXA-dependent enhancer of human alcohol dehydrogenase 4 (ADH4).
19925625 2010 Cluster headache is associated with the alcohol dehydrogenase 4 (ADH4) gene.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19861527 2009 Impact of multiple alcohol dehydrogenase gene polymorphisms on risk of upper aerodigestive tract cancers in a Japanese population.
19687126 2009 A non-synonymous variant in ADH1B is strongly associated with prenatal alcohol use in a European sample of pregnant women.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19193628 2009 ADH single nucleotide polymorphism associations with alcohol metabolism in vivo.
19182438 2009 Polymorphisms in the promoter region of the human class II alcohol dehydrogenase (ADH4) gene affect both transcriptional activity and ethanol metabolism in Japanese subjects.
18996923 2009 Associations of ADH and ALDH2 gene variation with self report alcohol reactions, consumption and dependence: an integrated analysis.
18801187 2008 Recessive genetic mode of an ADH4 variant in substance dependence in African-Americans: A model of utility of the HWD test.
18331377 2008 Association of ADH and ALDH genes with alcohol dependence in the Irish Affected Sib Pair Study of alcohol dependence (IASPSAD) sample.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17069770 2007 Personality traits of agreeableness and extraversion are associated with ADH4 variation.
16787387 2006 Comparative functional analysis of human medium-chain dehydrogenases, short-chain dehydrogenases/reductases and aldo-keto reductases with retinoids.
16237392 2006 ADH4 gene variation is associated with alcohol dependence and drug dependence in European Americans: results from HWD tests and case-control association studies.
16220108 2005 ADH4 gene variation is associated with alcohol and drug dependence: results from family controlled and population-structured association studies.
15863808 2005 Association of genetic variants in alcohol dehydrogenase 4 with alcohol dependence in Brazilian patients.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15369820 2004 Kinetics of human alcohol dehydrogenase with ring-oxidized retinoids: effect of Tween 80.
14745297 2004 Alcohol dehydrogenase polymorphisms influence alcohol-elimination rates in a male Jewish population.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12631290 2003 Distribution of class I, III and IV alcohol dehydrogenase mRNAs in the adult rat, mouse and human brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997393 2002 Kinetic mechanism of human class IV alcohol dehydrogenase functioning as retinol dehydrogenase.
11900616 2001 Alcohol dehydrogenase ADH2-1 and ADH2-2 allelic isoforms in the Russian population correlate with type of alcoholic disease.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11279029 2001 Biosynthesis of 9-cis-retinoic acid in vivo. The roles of different retinol dehydrogenases and a structure-activity analysis of microsomal retinol dehydrogenases.
11009184 2000 Alcohol dehydrogenase alleles in Parkinson's disease.
10407146 1999 Molecular docking studies on interaction of diverse retinol structures with human alcohol dehydrogenases predict a broad role in retinoid ligand synthesis.
9570155 1998 Function of cis-acting elements in human alcohol dehydrogenase 4 (ADH4) promoter and role of C/EBP proteins in gene expression.
8032153 1994 The alcohol dehydrogenase system.
3466164 1986 Human class II (pi) alcohol dehydrogenase has a redox-specific function in norepinephrine metabolism.
3036213 1987 Structure of the class II enzyme of human liver alcohol dehydrogenase: combined cDNA and protein sequence determination of the pi subunit.
1889753 1991 Cloning and characterization of the human ADH4 gene.
1362387 1992 Alcohol dehydrogenase genes: restriction fragment length polymorphisms for ADH4 (pi-ADH) and ADH5 (chi-ADH) and construction of haplotypes among different ADH classes.
9982 1976 Human liver alcohol dehydrogenase: purification, composition, and catalytic features.