Property Summary

NCBI Gene PubMed Count 208
PubMed Score 366.05
PubTator Score 227.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -2.100 1.4e-10
lung carcinoma -3.900 2.3e-34
non-small cell lung carcinoma -1.300 2.3e-08
psoriasis -1.500 6.8e-14

Protein-protein Interaction (8)

Gene RIF (220)

PMID Text
27239845 Even at early stages of malignant transformation, a significant decrease in ADH1B, ADH3, RDHL, and RALDH1 mRNA levels was observed in 82, 79, 73, and 64% of tumor specimens, respectively
26937962 Thus these findings suggest that the three variants of ADH1C, MnSOD and GSTM1 can be used to identify individuals who are at high risk to develop ALD and may be helpful in proper management of Indian alcoholics
26848198 the combination of genotypes ADH2 * 2, CYP2E1 * 1 combined with genotype homozygous ALDH2 * 1 found in this study could be leading to the population to a potential risk to alcoholism. The role of ADH3 was not indicated.
26634490 The ADH1C *1/*2 polymorphism is likely associated with pancreatitis risk.
26042511 ADH1B and ADH1C genetic variations are not related to the development of alcoholism or susceptibility to alcoholic cirrhosis.
25874489 ADH1B +3170A>G and ADH1C +13044A>G SNPs are associated with an increased risk of head and neck squamous cell carcinoma , and they could be used as biomarkers for the high-risk group of HNSCC in Koreans.
25524923 a positive association between inactive ADH1C G allele and alcohol consumption regarding gastric cancer risk was found, opposite to that found in previous studies
25503943 The study explores the association of ADH1B and ADH1C genotype with alcohol consumption and biomarkers of liver function.
25372623 findings suggest that ADH1C*2 is associated with alcohol dependence in the Turkish population displaying a dominant inheritance model. ADH1C*2 allele may contribute to the variance in heritability of alcohol dependence.
25311581 Among the Inuit in Greenland, ADH1C SNPs play a role in shaping their alcohol drinking patterns.
25208201 Young male East Indians with at least one ADH1C*2 allele feel less effects of alcohol, including nausea.
24735490 Results show that mutation of this protein confers associated protection against alcohol dependence. However these associations were not completely independent
24722735 ADH1B-ADH1C-ADH7 cluster SNPs confer susceptibility to esophageal squamous cell carcinoma
24599561 Decreased expression of ADH1C gene is associated with disease progression.
24217933 UGT1A1 allele 28 and ADH1C and B polymorphisms do not predict increased risk of hepatotoxicity during pegvisomant therapy
23895337 Alcohol dehydrogenase (ADH)1B and ADH1C are jointly associated with alcohol use disorders, but not consumption.
23516558 additional support for the association of SNP rs1614972 in ADH1C with alcohol dependence
23468174 common ADH variants conferred risk for both schizophrenia in African-Americans and autism in European-Americans.
23404349 ADH1C polymorphism is not associated with childhood acute leukemia and maternal caffeinated beverage consumption during pregnancy.
23321361 study failed to find any link between the ADH1C genotype and the cardioprotective effects of alcohol
22931071 No associations between alcohol dependence and polymorphisms in ADH1C were found in Mexican and Native Americans
22930414 did not observe association of ADH1C polymorphism with esophageal cancer
22675424 ADH1C Ile350Val polymorphism may contribute to cancer risk among Africans and Asians.
22476623 findings support that ADH1C Ile may lower the risk of alcohol dependence and alcohol abuse as well as alcohol-related cirrhosis in pooled populations, with the strongest and most consistent effects in Asians
22414625 Findings suggest that a significantly higher presence of ADH1C*2 allele is associated with alcohol dependence in a Turkish population.
22363810 Polymorphisms in ADH1B or ADH1C were not significantly associated with risk of cardiovascular diseases.
22353233 This meta-analysis suggests that ADH1C polymorphism may not be associated with breast cancer development in Caucasians.
22325912 No profound connection between alcohol dependence and ADH1C Ile350Val gene polymorphism was detected.
22279680 The frequency of ALDH2*2 and ADH3*1 alleles in risk drinkers was lower than that in safe drinkers in a male Tibetan population.
22048268 joint analysis showed that when combined with the wild type ADH1C Arg272/Ile350 allele, the ADH1B 48His is protective against chronic liver disease
22004471 The region harboring the ADH gene cluster has shown evidence of association in a number of candidate gene studies of alcohol dependence.
21917409 in a study of alcohol metabolic genotypes in drunk drivers, the rs698 ADH1C and rs671 ALDH2 polymorphisms were not associated with MCV
21705789 This study suggested that the ADH1C Sspl polymorphism could play a significant role in the etiology of oral cancer.
21482329 The presence of ADH3 in normal lung development (A549 cell line), & the capacity to convert retinol to retinoic acid, indicates that fetal human lung has the ability to regulate the supply of vitamin A from the pseudoglandular stage.
21303386 This study shows differences in the distribution of the frequency of allele ADH1C*1 between the Basque Country and Moroccan populations, and a new allele not described to date.
21163612 the ADH1C*2/*2 genotype was associated with a 42% increase in risk of colorectal cancer when compared with the ADH1C*1/*1 genotype.
20810466 The increased risk of oral clefts was evident only in mothers or children who carried the ADH1C haplotype associated with reduced alcohol metabolism.
20810466 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20700531 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20615890 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20568895 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20494945 Observational study of gene-disease association. (HuGE Navigator)
20477767 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20448861 These findings suggest that a lower presence of ADH1C*1 allele is associated with squamous cell carcinoma of the head and neck
20448861 Observational study of gene-disease association. (HuGE Navigator)
20437850 Results suggest that the ADH1C allele modifies the carcinogenic dose response for alcohol in the upper aerodigestive tract, giving rise to a gene-environment interaction.
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
20401433 subjects with ADH1C*1/*1 and CYP2E1*c1/*c2 genotypes become alcohol dependent at a considerably younger age than the subjects with ADH1C*1/*2, ADH1C*2/*2 and CYP2E1*c1/*c1 genotypes.
20401433 Observational study of gene-disease association. (HuGE Navigator)
20357489 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20350778 Among variant allele carriers of ADH1C Arg(272)Gln, alcohol intake increased the risk of breast cancer with 14% (95% CI: 1.04-1.24) per 10g alcohol/day.
20350778 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20205700 Observational study of gene-disease association. (HuGE Navigator)
20180013 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20171022 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20101753 Besides the identification of new genetic factors related to alcohol biodisposition relevant to whites, this study provides unambiguous identification of diplotypes related to variability in alcohol biodisposition.
20101753 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20031627 ADH1B and ADH1C genotypes were not associated with risk of myocardial infarction.
20031627 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19887496 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19861527 ADH1C gene polymorphisms are associated with upper aerodigestive tract cancers.
19861527 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19812523 ADH1C polymorphisms were not significantly associated with pancreatic cancer risk.
19812523 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19618839 Polymorphisms in the untranslated regions of ADH class I genes were demonstrated to clearly affect individual differences in alcohol metabolism.
19618839 Observational study of gene-disease association. (HuGE Navigator)
19581569 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19550411 ADH1C genotypes were not associated with and did not modify the effect of alcohol on biochemical tests or risk of liver disease.
19550411 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19486361 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19447389 Report associations between genetic variation of alcohol dehydrogenase type 1C (ADH1C), alcohol consumption, and metabolic cardiovascular risk factors.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19193628 Observational study of gene-disease association. (HuGE Navigator)
19189524 Results suggest a slightly increased risk of larynx cancer for indeividuals who have inherited the ADH1C*1 allele, however results were not at statistic significance level.
19189524 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19120062 ADH1C homozygosity is a genetic risk marker for colorectal tumors in individuals consuming more than 30 g alcohol per day.
19120062 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19068087 Polymorphisms in ADH1C is associated with pancreatic cancer.
19068087 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19038239 Reduction of S-nitrosoglutathione by alcohol dehydrogenase 3 is facilitated by substrate alcohols via direct cofactor recycling and leads to GSH-controlled formation of glutathione transferase inhibitors
19019335 Observational study of gene-disease association. (HuGE Navigator)
18996923 Observational study of gene-disease association. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18773092 Observational study of gene-disease association. (HuGE Navigator)
18761854 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18331377 Observational study of gene-disease association. (HuGE Navigator)
18268116 Polymorphisms in ADH1C may not be associated with risk of colorectal adenoma, but may interact with nutrients in the one-carbon pathway to affect adenoma risk.
18268116 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18266839 study suggests the association of ADH1C*2/*2/MTHFR 677TT genotype combination as a risk factor for oral squamous cell carcinoma in alcoholics
18266839 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18254707 It was observed that ADH variants, ADH2*1 and ADH3*2, were associated with increased risk for oesophageal cancer, possibly due to the tolerance of the carriers of these alleles to alcohol consumption
18254707 Observational study of gene-disease association. (HuGE Navigator)
18043297 Alcohol dehydrogenase modifies the effect of alcohol consumption on coronary risk. The results support the protective effect of alcohol consumption on CHD risk and suggest a causal association of alcohol intake and lower CHD risk.
17923853 individuals with ADH1C slow vs fast alcohol degradation had a higher risk of heavy and excessive drinking.
17923853 Observational study of gene-disease association. (HuGE Navigator)
17885622 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17665311 Observational study of gene-disease association. (HuGE Navigator)
17665311 Data suggest that ADH3 genotype may be associated with risk of esophageal and stomach cardia adenocarcionoma.
17631643 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17629074 Observational study of gene-disease association. (HuGE Navigator)
17563066 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17563066 ADH1C*2 allele, related to slower oxidation rate, attenuates the lower diabetes risk among moderate to heavy drinkers.
17559142 examined genetic polymorphisms in the alcohol dehydrogenase 3, aldehyde dehydrogenase 2, and cytochrome P450 2E1 genes in 505 patients with histologically confirmed lung cancer and 256 noncancer controls to determine association with alcohol drinking
17543846 The ADH1C*1 allele frequency and rate of homozygosity was significantly associated with an increased risk for alcohol-related cancer.
17517051 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17454860 Observational study of gene-disease association. (HuGE Navigator)
17449906 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17421009 Observational study of genotype prevalence. (HuGE Navigator)
17421009 The researchers found evidence for a functional allele polymorphic with a strong specific linkage disequilibrium in an Indian population, and this is an important factor in the metabolism of ethanol to acetaldehyde.
17379229 Our findings do not support the hypothesis that ADH1C variants are associated with coronary heart disease risk in people who drink moderately.
17379229 Observational study of gene-disease association. (HuGE Navigator)
17295732 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17295732 Low levels of alcohol are associated with a modest increase in breast cancer risk that is not altered by known functional allelic variants of the ADH1C gene.
17285601 Observational study of gene-disease association. (HuGE Navigator)
17268812 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17268812 Polymorphisms in ADH1C is associated with breast cancer
17185388 Observational study of gene-disease association. (HuGE Navigator)
17134660 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17134660 These results suggest that ADH1C polymorphisms are associated with alcohol dependence and alcohol associated elevations of liver enzymes in a population with a low frequency of ADH1B2 alleles.
17071628 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17071628 Genetic polymorphisms of ADH1C is associated with oral and pharyngeal squamous cell carcinoma
17018785 Observational study of gene-disease association. (HuGE Navigator)
16930209 Observational study of gene-disease association. (HuGE Navigator)
16801984 Observational study of genotype prevalence. (HuGE Navigator)
16758956 There were no differences in the frequencies of genotypes of ADH2 and ADH3 between trichloroethylene-induced medicamentosa-like dermatitis cases and exposed controls.
16758956 Observational study of gene-disease association. (HuGE Navigator)
16737450 findings suggest that the alcohol dehydrogenase IB and IC genes are regulated by epigenetic mechanisms in human hepatoma cells
16685648 Observational study of gene-disease association. (HuGE Navigator)
16675441 HNF1 binding, at approximately 51 kb upstream, plays a master role in controlling human class I alcohol dehydrogenase gene expression.
16600530 Observational study of gene-disease association. (HuGE Navigator)
16440362 Meta-analysis of gene-disease association. (HuGE Navigator)
16415175 Observational study of gene-disease association. (HuGE Navigator)
16344274 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16287084 Observational study of gene-disease association. (HuGE Navigator)
16239350 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16184481 No effects of the ADH1C*349Ile alleles on in vivo ethanol metabolism were observed. This implies that there is a major determinant of variation for in vivo alcohol metabolism in the ADH region that is not accounted for by this polymorphism.
16132793 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16132793 Alcohol dehydrogenase 3 null genotypes did not modify the risk of HCC due to alcohol intake.
16117582 Observational study of gene-disease association. (HuGE Navigator)
16086315 Observational study of gene-disease association. (HuGE Navigator)
16086315 polymorphisms in ADH1C and ADH1B may have roles in the risk of alcoholism
16051248 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16051248 ADH1C genotype modifies the association between alcohol consumption and HDL levels among men and postmenopausal women not using postmenopausal hormones who drink moderately
16039674 Observational study of gene-disease association. (HuGE Navigator)
16018848 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15941567 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15941567 Conversely, in both genders, no differences were found between ADH3 genotypes regarding all cardiovascular risk factors studied and carotid intima-media thickness.
15910847 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15902904 No association has been revealed for the alcohol metabolism-related ADH3 genotype and Korean patients with alcoholism compared to Korean control subjects without alcoholism.
15897724 Observational study of gene-disease association. (HuGE Navigator)
15897724 mean corpuscular volume values were not associated with genotype polymorphisms of ADH1C
15863807 Observational study of gene-disease association. (HuGE Navigator)
15842377 a slower alcohol clearance rate is associated with the ADH3 y2 allele [letter]
15767341 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15734975 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15654505 Observational study of gene-disease association. (HuGE Navigator)
15643610 ADH1C polymorphisms in the cis-acting elements affect transcription.
15642852 Observational study of gene-disease association. (HuGE Navigator)
15642852 mutations in genes encoding ADH1C (G78Stop) as genetic risk factors for Parkinson disease .
15519646 Observational study of gene-disease association. (HuGE Navigator)
15511718 Observational study of gene-disease association. (HuGE Navigator)
15375565 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15370874 Observational study of gene-disease association. (HuGE Navigator)
15327835 Observational study of gene-disease association. (HuGE Navigator)
15318112 Observational study of gene-disease association. (HuGE Navigator)
15220553 Observational study of gene-disease association. (HuGE Navigator)
15138216 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14745297 Observational study of gene-disease association. (HuGE Navigator)
14732773 Observational study of gene-disease association. (HuGE Navigator)
14726542 Observational study of gene-disease association. (HuGE Navigator)
14693654 Observational study, meta-analysis, and HuGE review of genotype prevalence, gene-disease association, and gene-environment interaction. (HuGE Navigator)
14691069 Observational study of gene-disease association. (HuGE Navigator)
14634838 Observational study of genotype prevalence. (HuGE Navigator)
14608084 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12915519 Observational study of gene-disease association. (HuGE Navigator)
12884000 Observational study of gene-disease association. (HuGE Navigator)
12782305 gastric ADH3 may highly effectively contribute to the first-pass metabolism at 0.5-3 M ethanol, an attainable range in the gastric lumen during alcohol consumption
12750236 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12713190 adh3 gene is implicated in alcoholism incidence among African Americans
12710951 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12668919 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12668919 Polymorphism is not associated with laryngeal cancer risk in Caucasians.
12658118 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12658118 There is no significant interaction between alcohol consumption and ADH3 genotype.
12631283 Results suggest that alcohol dehydrogenase 3 catalysed S-nitrosoglutathione reduction is of physiological relevance in the metabolism of NO in humans.
12554615 Polymorphisms of alcohol-metabolizing enzymes: analyses of mutations on the CYP2E1, ADH2, ADH3 and ALDH2 genes in a Mexican-American population living in the Los Angeles area.
12517056 Observational study of gene-disease association. (HuGE Navigator)
12505800 Observational study of gene-disease association. (HuGE Navigator)
12500098 A new coding variant has been identified at codon 351 of ADH1C, an allele found in most Native American populations studied, with allele frequencies of the new ADH1C*351Thr allele as high as 26%.
12376487 Observational study of gene-disease association. (HuGE Navigator)
12173598 Observational study of gene-disease association. (HuGE Navigator)
11966948 Observational study of gene-disease association. (HuGE Navigator)
11802217 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11752857 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11748356 Observational study of gene-disease association. (HuGE Navigator)
11740346 Observational study of genotype prevalence. (HuGE Navigator)
11700261 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11696658 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11303599 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11207350 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11159741 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11051375 Observational study of gene-disease association. (HuGE Navigator)
11045794 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEA      1 - 70
AGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHH     71 - 140
FVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVM    141 - 210
GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL    211 - 280
LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNI    281 - 350
LPFEKINEGFDLLRSGKSIRTVLTF                                                 351 - 375
//

Text Mined References (211)

PMID Year Title
27239845 [Abnormal expression of genes that regulate retinoid metabolism and signaling in non-small-cell lung cancer].
26937962 2016 Genetic Association and Gene-Gene Interaction Reveal Genetic Variations in ADH1B, GSTM1 and MnSOD Independently Confer Risk to Alcoholic Liver Diseases in India.
26848198 2015 Characterization of polymorphisms of genes ADH2, ADH3, ALDH2 and CYP2E1 and relationship to the alcoholism in a Colombian population.
26634490 2015 Association between alcohol dehydrogenase 1C gene *1/*2 polymorphism and pancreatitis risk: a meta-analysis.
26042511 2015 Genetic polymorphisms of ADH1B, ADH1C and ALDH2 in Turkish alcoholics: lack of association with alcoholism and alcoholic cirrhosis.
25874489 2015 Association between ADH1B and ADH1C polymorphisms and the risk of head and neck squamous cell carcinoma.
25524923 2015 Genetic polymorphisms of ADH1B, ADH1C and ALDH2, alcohol consumption, and the risk of gastric cancer: the Japan Public Health Center-based prospective study.
25503943 2014 ADH1B and ADH1C genotype, alcohol consumption and biomarkers of liver function: findings from a Mendelian randomization study in 58,313 European origin Danes.
25372623 2015 Association between ADH1C and ALDH2 polymorphisms and alcoholism in a Turkish sample.
25311581 2014 Genetic variation in alcohol metabolizing enzymes among Inuit and its relation to drinking patterns.
25208201 2014 Subjective response to alcohol and ADH polymorphisms in a select sample of young adult male East Indians and Africans in Trinidad and Tobago.
24735490 2015 Genetic variants in or near ADH1B and ADH1C affect susceptibility to alcohol dependence in a British and Irish population.
24722735 2014 Replication study of ESCC susceptibility genetic polymorphisms locating in the ADH1B-ADH1C-ADH7 cluster identified by GWAS.
24599561 2014 Altered expression of multiple genes involved in retinoic acid biosynthesis in human colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24217933 2014 Role of UGT1A1 and ADH gene polymorphisms in pegvisomant-induced liver toxicity in acromegalic patients.
23895337 2013 Alcohol-metabolizing genes and alcohol phenotypes in an Israeli household sample.
23516558 2013 Replication of genome wide association studies of alcohol dependence: support for association with variation in ADH1C.
23468174 2013 Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.
23456092 2013 Extended genetic effects of ADH cluster genes on the risk of alcohol dependence: from GWAS to replication.
23404349 2013 Childhood acute leukemia, maternal beverage intake during pregnancy, and metabolic polymorphisms.
23321361 2013 Is ADH1C genotype relevant for the cardioprotective effect of alcohol?
22931071 2012 ADH and ALDH polymorphisms and alcohol dependence in Mexican and Native Americans.
22930414 2013 Single nucleotide polymorphisms of ADH1B, ADH1C and ALDH2 genes and esophageal cancer: a population-based case-control study in China.
22675424 2012 ADH1C Ile350Val polymorphism and cancer risk: evidence from 35 case-control studies.
22476623 2012 Further clarification of the contribution of the ADH1C gene to vulnerability of alcoholism and selected liver diseases.
22414625 2012 Association of a genetic polymorphism of the alcohol-metabolizing enzyme ADH1C with alcohol dependence: results of a case-control study.
22363810 2012 Alcohol consumption, genetic variants in alcohol deydrogenases, and risk of cardiovascular diseases: a prospective study and meta-analysis.
22353233 2012 Lack of association of ADH1C genotype with breast cancer susceptibility in Caucasian population: a pooled analysis of case-control studies.
22325912 2012 Determination of the effects of alcohol dehydrogenase (ADH) 1B and ADH1C polymorphisms on alcohol dependence in Turkey.
22279680 2011 [Genetic polymorphism of ADH3 and ALDH2 among Tibetan population in Qinghai and its relationship with drinking behavior].
22048268 2011 Combined effect of ADH1B RS1229984, RS2066702 and ADH1C RS1693482/ RS698 alleles on alcoholism and chronic liver diseases.
22004471 2012 Genome-wide significant association between alcohol dependence and a variant in the ADH gene cluster.
21917409 2012 Alcohol drinking, mean corpuscular volume of erythrocytes, and alcohol metabolic genotypes in drunk drivers.
21705789 2011 Genetic polymorphisms of ADH1C and CYP2E1 and risk of oral squamous cell carcinoma.
21482329 2011 [A study of the metabolic pathways of vitamin A in the fetal human lung].
21437268 2011 A genome-wide association study of upper aerodigestive tract cancers conducted within the INHANCE consortium.
21303386 2011 Alcohol-metabolizing enzyme gene polymorphisms in the Basque Country, Morocco, and Ecuador.
21163612 2011 Alcohol consumption, alcohol dehydrogenase 1C (ADH1C) genotype, and risk of colorectal cancer in the Netherlands Cohort Study on diet and cancer.
20810466 2010 Maternal alcohol consumption, alcohol metabolism genes, and the risk of oral clefts: a population-based case-control study in Norway, 1996-2001.
20700531 2010 The association of alcohol and alcohol metabolizing gene variants with diabetes and coronary heart disease risk factors in a white population.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20615890 2010 A candidate gene study of folate-associated one carbon metabolism genes and colorectal cancer risk.
20568895 2010 Polymorphisms in metabolizing enzymes and the risk of head and neck squamous cell carcinoma in the Slavic population of the central Europe.
20494945 2010 Alcohol drinking habits, alcohol dehydrogenase genotypes and risk of acute coronary syndrome.
20477767 2010 Polymorphisms of alcohol dehydrogenase-1B and aldehyde dehydrogenase-2 and the blood and salivary ethanol and acetaldehyde concentrations of Japanese alcoholic men.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20448861 2010 Frequencies of ADH1C alleles and genotypes in a Turkish head and neck cancer population.
20437850 Alcohol, tobacco and genetic susceptibility in relation to cancers of the upper aerodigestive tract in northern Italy.
20437058 2010 The utility and predictive value of combinations of low penetrance genes for screening and risk prediction of colorectal cancer.
20401433 2010 Genetic polymorphism of alcohol-metabolizing enzyme and alcohol dependence in Polish men.
20357489 2010 Immunoglobulin E sensitization to cross-reactive carbohydrate determinants: epidemiological study of clinical relevance and role of alcohol consumption.
20350778 2010 Interaction between ADH1C Arg(272)Gln and alcohol intake in relation to breast cancer risk suggests that ethanol is the causal factor in alcohol related breast cancer.
20205700 2010 Genetic determinants of both ethanol and acetaldehyde metabolism influence alcohol hypersensitivity and drinking behaviour among Scandinavians.
20180013 2010 Genetic polymorphisms in folate and alcohol metabolism and breast cancer risk: a case-control study in Thai women.
20171022 2010 Association of polymorphism in alcohol dehydrogenase and interaction with other genetic risk factors with alcoholic liver cirrhosis.
20101753 2010 Variability in ethanol biodisposition in whites is modulated by polymorphisms in the ADH1B and ADH1C genes.
20031627 2009 Alcohol intake, myocardial infarction, biochemical risk factors, and alcohol dehydrogenase genotypes.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19887496 Polymorphisms in alcohol metabolizing genes and the risk of head and neck cancer in a Brazilian population.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19861527 2009 Impact of multiple alcohol dehydrogenase gene polymorphisms on risk of upper aerodigestive tract cancers in a Japanese population.
19812523 2010 CYP2A13, ADH1B, and ADH1C gene polymorphisms and pancreatic cancer risk.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19618839 2009 Effects of polymorphisms in untranslated regions of the class I alcohol dehydrogenase (ADH) genes on alcohol metabolism in Japanese subjects and transcriptional activity in HepG2 cells.
19581569 2009 Genome-wide association study of alcohol dependence.
19550411 2009 Alcohol intake, alcohol dehydrogenase genotypes, and liver damage and disease in the Danish general population.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19486361 2010 Alcohol dehydrogenase 2 genotype and risk for migraine.
19447389 2009 Genetic variation of alcohol dehydrogenase type 1C (ADH1C), alcohol consumption, and metabolic cardiovascular risk factors: results from the IMMIDIET study.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19193628 2009 ADH single nucleotide polymorphism associations with alcohol metabolism in vivo.
19189524 2008 [Distribution of alcohol dehydrogenase (ADH1C) genotypes in subjects with tobacco smoke-associated laryngeal cancer].
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19120062 2009 Alcohol and colorectal cancer: the role of alcohol dehydrogenase 1C polymorphism.
19068087 2009 Impact of alcohol consumption with polymorphisms in alcohol-metabolizing enzymes on pancreatic cancer risk in Japanese.
19038239 2009 The Janus face of alcohol dehydrogenase 3.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18996923 2009 Associations of ADH and ALDH2 gene variation with self report alcohol reactions, consumption and dependence: an integrated analysis.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18846501 2008 Does parental expressed emotion moderate genetic effects in ADHD? An exploration using a genome wide association scan.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18773092 2008 Alcohol-metabolizing enzyme gene polymorphisms and alcohol chronic pancreatitis among Polish individuals.
18761854 2008 [Genetic variations in alcohol dehydrogenase, drinking habits and alcoholism].
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18331377 2008 Association of ADH and ALDH genes with alcohol dependence in the Irish Affected Sib Pair Study of alcohol dependence (IASPSAD) sample.
18268116 2008 DNA methyltransferase and alcohol dehydrogenase: gene-nutrient interactions in relation to risk of colorectal polyps.
18266839 2008 Polymorphism in ADH and MTHFR genes in oral squamous cell carcinoma of Indians.
18254707 2008 Genetic polymorphisms of alcohol metabolising enzymes: their role in susceptibility to oesophageal cancer.
18043297 2007 Alcohol consumption, alcohol dehydrogenase and risk of coronary heart disease in the MONICA/KORA-Augsburg cohort 1994/1995-2002.
17923853 2008 Alcoholism and alcohol drinking habits predicted from alcohol dehydrogenase genes.
17885622 2007 Pharmacokinetic and pharmacodynamic basis for partial protection against alcoholism in Asians, heterozygous for the variant ALDH2*2 gene allele.
17665311 2007 Alcohol dehydrogenase 3 and risk of esophageal and gastric adenocarcinomas.
17631643 2007 Genetic polymorphisms in alcohol metabolism, alcohol intake and the risk of stomach cancer in Warsaw, Poland.
17629074 2007 Genetic polymorphism of alcohol dehydrogenase 3 in digestive tract alcohol damage.
17563066 2007 Alcohol consumption and type 2 diabetes: influence of genetic variation in alcohol dehydrogenase.
17559142 2007 Susceptibility to lung cancer and genetic polymorphisms in the alcohol metabolite-related enzymes alcohol dehydrogenase 3, aldehyde dehydrogenase 2, and cytochrome P450 2E1 in the Japanese population.
17543846 2007 The role of acetaldehyde in upper digestive tract cancer in alcoholics.
17517051 2007 Alcohol dehydrogenase and aldehyde dehydrogenase polymorphisms and colorectal cancer: the Fukuoka Colorectal Cancer Study.
17454860 2007 Alcohol dehydrogenase and aldehyde dehydrogenase gene polymorphism in alcohol liver cirrhosis and alcohol chronic pancreatitis among Polish individuals.
17449906 2007 Genetic polymorphisms in one-carbon metabolism: associations with CpG island methylator phenotype (CIMP) in colon cancer and the modifying effects of diet.
17421009 Single nucleotide polymorphisms in alcohol dehydrogenase genes among some Indian populations.
17379229 2008 Alcohol dehydrogenase type 1C (ADH1C) variants, alcohol consumption traits, HDL-cholesterol and risk of coronary heart disease in women and men: British Women's Heart and Health Study and Caerphilly cohorts.
17295732 2007 Alcohol dehydrogenase genetic polymorphisms, low-to-moderate alcohol consumption, and risk of breast cancer.
17285601 2007 Impact of the alcohol-dehydrogenase (ADH) 1C and ADH1B polymorphisms on drinking behavior in nonalcoholic Japanese.
17268812 2007 Alcohol metabolism, alcohol intake, and breast cancer risk: a sister-set analysis using the Breast Cancer Family Registry.
17185388 2007 Multiple ADH genes modulate risk for drug dependence in both African- and European-Americans.
17134660 2006 ADH1C*2 allele is associated with alcohol dependence and elevated liver enzymes in Trinidad and Tobago.
17071628 2007 Genetic polymorphisms of alcohol and aldehyde dehydrogenases, and drinking, smoking and diet in Japanese men with oral and pharyngeal squamous cell carcinoma.
17018785 2006 Commonly studied single-nucleotide polymorphisms and breast cancer: results from the Breast Cancer Association Consortium.
16930209 2006 Associations of variations in alcohol dehydrogenase genes with the level of response to alcohol in non-Asians.
16801984 2006 Variant alleles and genotypes of alcohol dehydrogenase 3 in a Turkish population.
16758956 2006 [Polymorphisms of aldehyde and alcohol dehydrogenase genes associated with susceptibility to trichloroethylene-induced medicamentosa-like dermatitis].
16737450 2006 Differential regulation of the alcohol dehydrogenase 1B (ADH1B) and ADH1C genes by DNA methylation and histone deacetylation.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16685648 2006 Diplotype trend regression analysis of the ADH gene cluster and the ALDH2 gene: multiple significant associations with alcohol dependence.
16675441 2006 Distant HNF1 site as a master control for the human class I alcohol dehydrogenase gene expression.
16600530 2006 Polymorphisms of alcohol-metabolizing enzymes and the risk for alcoholism and alcoholic liver disease in Caucasian Spanish women.
16440362 2006 Do alcohol-metabolizing enzyme gene polymorphisms increase the risk of alcoholism and alcoholic liver disease?
16415175 2006 High throughput SNP and expression analyses of candidate genes for non-syndromic oral clefts.
16344274 2006 ADH3 genotype, alcohol intake and breast cancer risk.
16287084 2006 Alcohol dehydrogenase 1C*1 allele is a genetic marker for alcohol-associated cancer in heavy drinkers.
16239350 Genetic polymorphism of alcohol dehydrogenase 3 in alcohol liver cirrhosis and in alcohol chronic pancreatitis.
16184481 2005 Genetic time-series analysis identifies a major QTL for in vivo alcohol metabolism not predicted by in vitro studies of structural protein polymorphism at the ADH1B or ADH1C loci.
16132793 2005 Alcohol dehydrogenase 3, glutathione S-transferase M1 and T1 polymorphisms, alcohol consumption and hepatocellular carcinoma (Italy).
16117582 2005 Genetic associations of alcohol dehydrogenase with alcohol use disorders and endophenotypes in white college students.
16086315 2005 Scanning of genetic effects of alcohol metabolism gene (ADH1B and ADH1C) polymorphisms on the risk of alcoholism.
16051248 2005 Alcohol consumption and high-density lipoprotein levels: the effect of ADH1C genotype, gender and menopausal status.
16039674 2006 Role of epoxide hydrolase, NAD(P)H:quinone oxidoreductase, cytochrome P450 2E1 or alcohol dehydrogenase genotypes in susceptibility to colorectal cancer.
16018848 2005 Influence of alcohol dehydrogenase 1C polymorphism on the alcohol-cardiovascular disease association (from the Framingham Offspring Study).
15941567 2006 Lack of association between ADH3 polymorphism, alcohol intake, risk factors and carotid intima-media thickness.
15910847 2005 Genetic variation in alcohol dehydrogenase 1C and the beneficial effect of alcohol intake on coronary heart disease risk in the Second Northwick Park Heart Study.
15902904 Association of polymorphisms in nicotinic acetylcholine receptor alpha 4 subunit gene (CHRNA4), mu-opioid receptor gene (OPRM1), and ethanol-metabolizing enzyme genes with alcoholism in Korean patients.
15897724 2005 Mean corpuscular volume and ADH1C genotype in white patients with alcohol-associated diseases.
15863807 2005 Alcohol and aldehyde dehydrogenase polymorphisms in men with type I and Type II alcoholism.
15842377 2005 Genetic variation in alcohol dehydrogenase 3 and the decrease of hs-C-reactive protein levels by moderate alcohol consumption.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15767341 2005 Alcohol dehydrogenase 3 and risk of squamous cell carcinomas of the head and neck.
15734975 2005 The ADH1C polymorphism modifies the risk of squamous cell carcinoma of the head and neck associated with alcohol and tobacco use.
15654505 2005 Association of habitual smoking and drinking with single nucleotide polymorphism (SNP) in 40 candidate genes: data from random population-based Japanese samples.
15643610 2005 Natural haplotypes in the regulatory sequences affect human alcohol dehydrogenase 1C (ADH1C) gene expression.
15642852 2005 A rare truncating mutation in ADH1C (G78Stop) shows significant association with Parkinson disease in a large international sample.
15519646 2004 Genetic polymorphisms of ADH2, ADH3, CYP4502E1 Dra-I and Pst-I, and ALDH2 in Spanish men: lack of association with alcoholism and alcoholic liver disease.
15511718 Relation of genotypes of alcohol metabolizing enzymes and mortality of liver diseases in patients with alcohol dependence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15449945 2004 Structure of three class I human alcohol dehydrogenases complexed with isoenzyme specific formamide inhibitors.
15375565 2004 Risk factors in alcohol associated breast cancer: alcohol dehydrogenase polymorphism and estrogens.
15370874 Association of metabolic gene polymorphisms with alcohol consumption in controls.
15327835 2004 Genetic polymorphisms in three Iranian populations with different risks of esophageal cancer, an ecologic comparison.
15318112 2004 ADH1B*1, ADH1C*2, DRD2 (-141C Ins), and 5-HTTLPR are associated with alcoholism in Mexican American men living in Los Angeles.
15220553 2004 [Genetic polymorphisms of alcohol-metabolizing enzymes and cytokines in patients with alcohol induced pancreatitis and alcoholic liver cirrhosis].
15138216 2004 Increased cancer risk in heavy drinkers with the alcohol dehydrogenase 1C*1 allele, possibly due to salivary acetaldehyde.
14745297 2004 Alcohol dehydrogenase polymorphisms influence alcohol-elimination rates in a male Jewish population.
14732773 2004 Alcohol dehydrogenase 3 genotype as a risk factor for upper aerodigestive tract cancers.
14726542 2004 Prospective evaluation of the alcohol dehydrogenase gamma1/gamma2 gene polymorphism and risk of stroke.
14693654 2004 Pooled analysis of alcohol dehydrogenase genotypes and head and neck cancer: a HuGE review.
14691069 Genetic polymorphisms in alcohol-metabolizing enzymes and chronic pancreatitis.
14634838 2003 Allele frequencies of single nucleotide polymorphisms (SNPs) in 40 candidate genes for gene-environment studies on cancer: data from population-based Japanese random samples.
14608084 2003 Lung cancer in humans is not associated with lifetime total alcohol consumption or with genetic variation in alcohol dehydrogenase 3 (ADH3).
12915519 Investigation of alcohol metabolizing enzyme genes in Chinese alcoholics with avascular necrosis of hip joint, pancreatitis and cirrhosis of the liver.
12884000 2003 Allelic variation at alcohol metabolism genes ( ADH1B, ADH1C, ALDH2) and alcohol dependence in an American Indian population.
12782305 2003 The metabolic role of human ADH3 functioning as ethanol dehydrogenase.
12750236 2003 Alcohol consumption, alcohol dehydrogenase 3 polymorphism, and colorectal adenomas.
12713190 2003 Association of the ADH2*3 allele with greater alcohol expectancies in African-American young adults.
12710951 2003 The ADH3*2 and CYP2E1 c2 alleles increase the risk of alcoholism in Mexican American men.
12668919 2003 Laryngeal cancer risk in Caucasians is associated with alcohol and tobacco consumption but not modified by genetic polymorphisms in class I alcohol dehydrogenases ADH1B and ADH1C, and glutathione-S-transferases GSTM1 and GSTT1.
12658118 2003 ADH genotype does not modify the effects of alcohol on high-density lipoprotein.
12631283 2003 Reduction of S-nitrosoglutathione by human alcohol dehydrogenase 3 is an irreversible reaction as analysed by electrospray mass spectrometry.
12554615 Influence of genetic admixture on polymorphisms of alcohol-metabolizing enzymes: analyses of mutations on the CYP2E1, ADH2, ADH3 and ALDH2 genes in a Mexican-American population living in the Los Angeles area.
12517056 2002 Alcohol sensitivity in Taiwanese men with different alcohol and aldehyde dehydrogenase genotypes.
12505800 2003 Protective association of genetic variation in alcohol dehydrogenase with alcohol dependence in Native American Mission Indians.
12500098 2002 A proline-threonine substitution in codon 351 of ADH1C is common in Native Americans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376487 2002 Association between aldehyde dehydrogenase gene polymorphisms and the phenomenon of field cancerization in patients with head and neck cancer.
12173598 2002 Genotype of ethanol metabolizing enzyme genes by oligonucleotide microarray in alcoholic liver disease in Chinese people.
11966948 2002 Polymorphism in alcohol-metabolizing enzymes, glutathione S-transferases and apolipoprotein E and susceptibility to alcohol-induced cirrhosis and chronic pancreatitis.
11802217 2002 Interaction between a single nucleotide polymorphism in the alcohol dehydrogenase 3 gene, alcohol consumption and oral cancer risk.
11752857 2001 Alcohol dehydrogenase type 3 (ADH3) and the risk of bladder cancer.
11748356 2001 Association between polymorphisms of ethanol-metabolizing enzymes and susceptibility to alcoholic cirrhosis in a Korean male population.
11740346 2001 Functional polymorphism in the alcohol dehydrogenase 3 (ADH3) promoter.
11700261 2001 Oral squamous cell cancer risk in relation to alcohol consumption and alcohol dehydrogenase-3 genotypes.
11696658 2001 Testing genetic susceptibility loci for alcoholic heart muscle disease.
11303599 2001 Alcohol dehydrogenase 3 genotype is not associated with risk of squamous cell carcinoma of the oral cavity and pharynx.
11274460 2001 Three-dimensional structures of the three human class I alcohol dehydrogenases.
11207350 2001 Genetic variation in alcohol dehydrogenase and the beneficial effect of moderate alcohol consumption on myocardial infarction.
11159741 2001 Risk of head and neck cancer and the alcohol dehydrogenase 3 genotype.
11051375 2000 Chinese alcoholic patients with esophageal cancer are genetically different from alcoholics with acute pancreatitis and liver cirrhosis.
11045794 2000 A prospective study of the effect of alcohol consumption and ADH3 genotype on plasma steroid hormone levels and breast cancer risk.
10424757 1999 Recommended nomenclature for the vertebrate alcohol dehydrogenase gene family.
10405330 1999 Expression and localization of human alcohol and aldehyde dehydrogenase enzymes in skin.
8201622 1994 Structures of three human beta alcohol dehydrogenase variants. Correlations with their functional differences.
7771649 1995 Human stomach class IV alcohol dehydrogenase: molecular genetic analysis.
6391957 1984 Differential susceptibility of human alcohol dehydrogenase isoenzymes to anions.
6391921 1984 Human liver alcohol dehydrogenase. 2. The primary structure of the gamma 1 protein chain.
3758060 1986 The gamma 1 and gamma 2 subunits of human liver alcohol dehydrogenase. cDNA structures, two amino acid replacements, and compatibility with changes in the enzymatic properties.
3397059 1988 Genotyping of human alcohol dehydrogenases at the ADH2 and ADH3 loci following DNA sequence amplification.
3006456 1986 Genetics of human alcohol and aldehyde dehydrogenases.
2935875 1986 Three human alcohol dehydrogenase subunits: cDNA structure and molecular and evolutionary divergence.
2737681 1989 Chromosomal assignment of the alcohol dehydrogenase cluster locus to human chromosome 4q21-23 by in situ hybridization.
2347582 1990 The human class I alcohol dehydrogenase gene cluster: three genes are tandemly organized in an 80-kb-long segment of the genome.
2169444 1990 Promoters for the human alcohol dehydrogenase genes ADH1, ADH2, and ADH3: interaction of CCAAT/enhancer-binding protein with elements flanking the ADH2 TATA box.
1896463 1991 Structure of human beta 1 beta 1 alcohol dehydrogenase: catalytic effects of non-active-site substitutions.
1524834 1992 Molecular structure of the human alcohol dehydrogenase 3 gene.
9982 1976 Human liver alcohol dehydrogenase: purification, composition, and catalytic features.