Property Summary

NCBI Gene PubMed Count 44
PubMed Score 259.18
PubTator Score 171.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.800 2.6e-15
lung carcinoma -2.300 2.8e-32
non-small cell lung carcinoma -1.300 4.2e-18
ulcerative colitis -1.500 7.3e-07
psoriasis -1.800 3.3e-33

Gene RIF (29)

PMID Text
24762066 Data indicate that the up-regulation of aldehyde dehydrogenase-1 (ALDH1) after neoadjuvant chemotherapy (NAC) predicts poor survival in locally advanced breast cancer.
23891545 Unde-rexpression of the ADH1 gene, which influences the transformation of the extracellular matrix, plays a probable role in the etiology of uterine fibroid.
23769565 high levels of ADH1 transcription are implicated in fluconazole resistance in C. albicans and that the mRNA expression levels of ADH1 are positively correlated with those of CDR1, CDR2 and FLU1.
23468174 common ADH variants conferred risk for both schizophrenia in African-Americans and autism in European-Americans.
20872569 High ADH1 is associated with endometrial cancer.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19687126 Observational study of gene-disease association. (HuGE Navigator)
19618839 Observational study of gene-disease association. (HuGE Navigator)
19526455 ADH1A variation predisposes to personality traits and substance dependence
19526455 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19193628 Alleles of ADH7 SNPs were associated with the early stages of alcohol metabolism, with additional effects in the ADH1A, ADH1B and ADH4 regions.
19193628 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
18828806 Observational study of gene-disease association. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18331377 Observational study of gene-disease association. (HuGE Navigator)
17632320 The oxidative pathway of ethanol metabolism via ADH and ALDH does not play a role in pancreatic carcinogenesis.
17185388 Observational study of gene-disease association. (HuGE Navigator)
16685648 Observational study of gene-disease association. (HuGE Navigator)
16153155 GATA-2 and HNF-3beta regulate the human alcohol dehydrogenase 1A (ADH1A) gene.
15279067 Observational study of healthcare-related. (HuGE Navigator)
14634838 Observational study of genotype prevalence. (HuGE Navigator)
12081471 Structural aspects that influence dimer-tetramer formation.
11356310 Observational study of gene-disease association. (HuGE Navigator)
11303599 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVTPLPVILGHEA      1 - 70
AGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHH     71 - 140
FLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAIM    141 - 210
GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL    211 - 280
LCCHEACGTSVIVGVPPDSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHV    281 - 350
LPFEKINEGFDLLHSGKSIRTILMF                                                 351 - 375
//

Text Mined References (48)

PMID Year Title
24762066 2014 Changes in aldehyde dehydrogenase-1 expression during neoadjuvant chemotherapy predict outcome in locally advanced breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23891545 2013 The role of the alcohol dehydrogenase-1 (ADH1) gene in the pathomechanism of uterine leiomyoma.
23769565 2013 Alcohol dehydrogenase I expression correlates with CDR1, CDR2 and FLU1 expression in Candida albicans from patients with vulvovaginal candidiasis.
23468174 2013 Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.
23456092 2013 Extended genetic effects of ADH cluster genes on the risk of alcohol dependence: from GWAS to replication.
20872569 2010 The activity of class I, II, III, and IV alcohol dehydrogenase isoenzymes and aldehyde dehydrogenase in endometrial cancer.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19687126 2009 A non-synonymous variant in ADH1B is strongly associated with prenatal alcohol use in a European sample of pregnant women.
19618839 2009 Effects of polymorphisms in untranslated regions of the class I alcohol dehydrogenase (ADH) genes on alcohol metabolism in Japanese subjects and transcriptional activity in HepG2 cells.
19526455 2010 ADH1A variation predisposes to personality traits and substance dependence.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19193628 2009 ADH single nucleotide polymorphism associations with alcohol metabolism in vivo.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18828806 2008 Alterations in ethyl alcohol pharmacokinetics during oral consumption of malt liquor beverages in African Americans.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18331377 2008 Association of ADH and ALDH genes with alcohol dependence in the Irish Affected Sib Pair Study of alcohol dependence (IASPSAD) sample.
17632320 2007 The activity of class I, II, III, and IV of alcohol dehydrogenase isoenzymes and aldehyde dehydrogenase in pancreatic cancer.
17185388 2007 Multiple ADH genes modulate risk for drug dependence in both African- and European-Americans.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16685648 2006 Diplotype trend regression analysis of the ADH gene cluster and the ALDH2 gene: multiple significant associations with alcohol dependence.
16153155 2005 GATA-2 and HNF-3beta regulate the human alcohol dehydrogenase 1A (ADH1A) gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15449945 2004 Structure of three class I human alcohol dehydrogenases complexed with isoenzyme specific formamide inhibitors.
15279067 2004 Genotype announcement in a genetic polymorphism study for health checkup examinees at Nagoya University Hospital.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14634838 2003 Allele frequencies of single nucleotide polymorphisms (SNPs) in 40 candidate genes for gene-environment studies on cancer: data from population-based Japanese random samples.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12392591 2002 Oxidation of celecoxib by polymorphic cytochrome P450 2C9 and alcohol dehydrogenase.
12081471 2002 Structural aspects of aldehyde dehydrogenase that influence dimer-tetramer formation.
12050823 2002 A global perspective on genetic variation at the ADH genes reveals unusual patterns of linkage disequilibrium and diversity.
11356310 2001 Alcohol dehydrogenase polymorphism and Parkinson's disease.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11303599 2001 Alcohol dehydrogenase 3 genotype is not associated with risk of squamous cell carcinoma of the oral cavity and pharynx.
11274460 2001 Three-dimensional structures of the three human class I alcohol dehydrogenases.
10424757 1999 Recommended nomenclature for the vertebrate alcohol dehydrogenase gene family.
3013304 1986 cDNA and protein structure for the alpha subunit of human liver alcohol dehydrogenase.
3006456 1986 Genetics of human alcohol and aldehyde dehydrogenases.
2935875 1986 Three human alcohol dehydrogenase subunits: cDNA structure and molecular and evolutionary divergence.
2920825 1989 Molecular structure of the human alcohol dehydrogenase 1 gene.
2737681 1989 Chromosomal assignment of the alcohol dehydrogenase cluster locus to human chromosome 4q21-23 by in situ hybridization.
2347582 1990 The human class I alcohol dehydrogenase gene cluster: three genes are tandemly organized in an 80-kb-long segment of the genome.
2169444 1990 Promoters for the human alcohol dehydrogenase genes ADH1, ADH2, and ADH3: interaction of CCAAT/enhancer-binding protein with elements flanking the ADH2 TATA box.
1620113 1992 Temporal expression of the human alcohol dehydrogenase gene family during liver development correlates with differential promoter activation by hepatocyte nuclear factor 1, CCAAT/enhancer-binding protein alpha, liver activator protein, and D-element-binding protein.
9982 1976 Human liver alcohol dehydrogenase: purification, composition, and catalytic features.