Property Summary

NCBI Gene PubMed Count 32
PubMed Score 492.20
PubTator Score 84.65

Knowledge Summary

Patent (3,365)

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 1.5e-02
glioblastoma -2.000 8.2e-03
medulloblastoma -1.100 5.8e-03
medulloblastoma, large-cell -3.300 4.0e-05
Atopic dermatitis -1.400 2.4e-03
adrenocortical adenoma 1.255 4.8e-02
lung adenocarcinoma -2.200 6.9e-22
aldosterone-producing adenoma -1.360 9.8e-03
psoriasis -1.500 1.4e-43
non-small cell lung carcinoma -1.300 2.6e-12
Breast cancer -1.400 1.8e-12
ductal carcinoma in situ -1.200 1.3e-02
invasive ductal carcinoma -1.700 6.7e-03
pituitary cancer 2.600 6.8e-03
chronic rhinosinusitis -1.210 6.6e-03

Gene RIF (18)

PMID Text
26235030 Results suggest that UNC5 and LPHN3 can simultaneously bind to FLRT3, forming a trimeric complex, and that FLRT3 may form transsynaptic complexes with both LPHN3 and UNC5.
25989180 LPHN3 confers ADHD susceptibility, and moderates methylphenidate treatment response in children and adolescents with ADHD.
25871512 Study examined the association between the LPHN3 rs6551665 A/G polymorphism and Attention deficit hyperactivity disorder (ADHD) in Korea; samples used in the study consisted of 150 ADHD children and 322 controls; ADHD children appeared to have a surplus of GG genotype, studies with larger sample sizes needed.
23317273 Increased LPHN3 mRNA expression levels correlated with axillary-node metastasis in breast cancer.
23245769 genetic association studies in Germany: Data suggest that, within a sample of patients with attention deficit disorder hyperactivity, SNPs in LPHN3 gene impacts behavioral and neurophysiological measures of cognitive response control.
22832519 A two-locus genetic interaction between LPHN3 and 11q predicts ADHD severity and long-term outcome.
22575564 The influence of LPHN3 genotype on attention deficit-hyperactivity disorder (ADHD) and addiction is mediated through alterations in transgenic monoamine signaling.
22486528 highly significant interaction between four SNPs and maternal stress during pregnancy and development of attention-deficit/hyperactivity disorder
22405201 This study demonistrated that LPHN3 and its ligand FLRT3 play an important role in glutamatergic synapse development.
22105624 This study identifying loci for aADHD and led to the identification of LPHN3 as novel genes associated with ADHD across the lifespan.
21606926 single-nucleotide polymorphisms harbored in the LPHN3 gene interact with SNPs spanning the 11q region that contains DRD2 and NCAM1 genes, to double the risk of developing ADHD.
21432600 LPHN3, a new gene in which variants have recently been shown to be associated with adhd.
21184580 The mutational analysis of the entire coding region of LPHN3 in a cohort of 139 attention deficit hyperactivity disorder subjects and 52 controls, is reported.
21040458 These results further support the LPHN3 contribution to combined type ADHD, and specifically to the persistent form of the disorder
21040458 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20157310 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWPSQLLIFMMLLAPIIHAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDP      1 - 70
AQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVEQKVFLCPGLLK     71 - 140
GVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTG    141 - 210
FVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQ    211 - 280
NNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKD    281 - 350
SLVDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELE    351 - 420
RPSVKDISTTGPLGMGSTTTSTTLRTTTLSPGRSTTPSVSGRRNRSTSTPSPAVEVLDDMTTHLPSASSQ    421 - 490
IPALEESCEAVEAREIMWFKTRQGQIAKQPCPAGTIGVSTYLCLAPDGIWDPQGPDLSNCSSPWVNHITQ    491 - 560
KLKSGETAANIARELAEQTRNHLNAGDITYSVRAMDQLVGLLDVQLRNLTPGGKDSAARSLNKAMVETVN    561 - 630
NLLQPQALNAWRDLTTSDQLRAATMLLHTVEESAFVLADNLLKTDIVRENTDNIKLEVARLSTEGNLEDL    631 - 700
KFPENMGHGSTIQLSANTLKQNGRNGEIRVAFVLYNNLGPYLSTENASMKLGTEALSTNHSVIVNSPVIT    701 - 770
AAINKEFSNKVYLADPVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYWSTQGCRLLTTNKTHTTCSCNH    771 - 840
LTNFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIHKNLCISLFVA    841 - 910
ELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPAL    911 - 980
IVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLDNI    981 - 1050
KSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYGKCLRTHC   1051 - 1120
CSGKSTESSIGSGKTSGSRTPGRYSTGSQSRIRRMWNDTVRKQSESSFITGDINSSASLNREGLLNNARD   1121 - 1190
TSVMDTLPLNGNHGNSYSIASGEYLSNCVQIIDRGYNHNETALEKKILKELTSNYIPSYLNNHERSSEQN   1191 - 1260
RNLMNKLVNNLGSGREDDAIVLDDATSFNHEESLGLELIHEESDAPLLPPRVYSTENHQPHHYTRRRIPQ   1261 - 1330
DHSESFFPLLTNEHTEDLQSPHRDSLYTSMPTLAGVAATESVTTSTQTEPPPAKCGDAEDVYYKSMPNLG   1331 - 1400
SRNHVHQLHTYYQLGRGSSDGFIVPPNKDGTPPEGSSKGPAHLVTSL                          1401 - 1447
//

Text Mined References (33)

PMID Year Title
26235030 2015 Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion.
25989180 2015 LPHN3 and attention-deficit/hyperactivity disorder: a susceptibility and pharmacogenetic study.
25871512 2015 Association of LPHN3 rs6551665 A/G polymorphism with attention deficit and hyperactivity disorder in Korean children.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
23317273 2012 Quantitative real-time RT-PCR of ITGA7, SVEP1, TNS1, LPHN3, SEMA3G, KLB and MMP13 mRNA expression in breast cancer.
23245769 2013 Influence of a latrophilin 3 (LPHN3) risk haplotype on event-related potential measures of cognitive response control in attention-deficit hyperactivity disorder (ADHD).
22832519 2011 A two-locus genetic interaction between LPHN3 and 11q predicts ADHD severity and long-term outcome.
22575564 2012 Initial characterization of mice null for Lphn3, a gene implicated in ADHD and addiction.
22486528 2012 LPHN3 and attention-deficit/hyperactivity disorder: interaction with maternal stress during pregnancy.
22405201 2012 FLRT proteins are endogenous latrophilin ligands and regulate excitatory synapse development.
22105624 2012 The genetics of attention deficit/hyperactivity disorder in adults, a review.
21606926 2012 A cooperative interaction between LPHN3 and 11q doubles the risk for ADHD.
21432600 2010 Toward a better understanding of ADHD: LPHN3 gene variants and the susceptibility to develop ADHD.
21184580 2011 Screening of human LPHN3 for variants with a potential impact on ADHD susceptibility.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
21040458 2011 Contribution of LPHN3 to the genetic susceptibility to ADHD in adulthood: a replication study.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20522523 2010 Common genetic variation and susceptibility to partial epilepsies: a genome-wide association study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20157310 2010 A common variant of the latrophilin 3 gene, LPHN3, confers susceptibility to ADHD and predicts effectiveness of stimulant medication.
19043545 2008 Genetics meets metabolomics: a genome-wide association study of metabolite profiles in human serum.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
15066411 2004 The multiple actions of black widow spider toxins and their selective use in neurosecretion studies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11520923 2001 alpha-Latrotoxin and its receptors: neurexins and CIRL/latrophilins.
10994649 A family of heptahelical receptors with adhesion-like domains: a marriage between two super families.
10964907 2000 The calcium-independent receptor for alpha-latrotoxin from human and rodent brains interacts with members of the ProSAP/SSTRIP/Shank family of multidomain proteins.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9847074 1998 Toward a complete human genome sequence.
7937745 1994 Construction and characterization of a normalized cDNA library.