Property Summary

NCBI Gene PubMed Count 18
PubMed Score 81.63
PubTator Score 133.52

Knowledge Summary

Patent (115,065)

TINX Plot

  Disease (5)

Disease Target Count P-value
non-small cell lung carcinoma 413 8.9e-33
lung adenocarcinoma 2714 3.5e-15
diabetes mellitus 1663 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Autistic Disorder 320 0.0 1.0
Disease Target Count
Common variable immunodeficiency 98

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.100 1.3e-02
lung adenocarcinoma -2.100 3.5e-15
non-small cell lung carcinoma -2.200 8.9e-33

AA Sequence

MVSSGCRMRSLWFIIVISFLPNTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIESANYGRTDDK      1 - 70
ICDADPFQMENTDCYLPDAFKIMTQRCNNRTQCIVVTGSDVFPDPCPGTYKYLEVQYECVPYIFVCPGTL     71 - 140
KAIVDSPCIYEAEQKAGAWCKDPLQAADKIYFMPWTPYRTDTLIEYASLEDFQNSRQTTTYKLPNRVDGT    141 - 210
GFVVYDGAVFFNKERTRNIVKFDLRTRIKSGEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATE    211 - 280
QNNGMIVISQLNPYTLRFEATWETVYDKRAASNAFMICGVLYVVRSVYQDNESETGKNSIDYIYNTRLNR    281 - 350
GEYVDVPFPNQYQYIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELFKTIIST    351 - 420
TSTTSQKGPMSTTVAGSQEGSKGTKPPPAVSTTKIPPITNIFPLPERFCEALDSKGIKWPQTQRGMMVER    421 - 490
PCPKGTRGTASYLCMISTGTWNPKGPDLSNCTSHWVNQLAQKIRSGENAASLANELAKHTKGPVFAGDVS    491 - 560
SSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNKLQKREKTCRAYLKAIVDTVDNLLRPEALESWKHMNS    561 - 630
SEQAHTATMLLDTLEEGAFVLADNLLEPTRVSMPTENIVLEVAVLSTEGQIQDFKFPLGIKGAGSSIQLS    631 - 700
ANTVKQNSRNGLAKLVFIIYRSLGQFLSTENATIKLGADFIGRNSTIAVNSHVISVSINKESSRVYLTDP    701 - 770
VLFTLPHIDPDNYFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIAYKD    771 - 840
GVHELLLTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIGIDKTKYAIAC    841 - 910
PIFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLFPATVVGVSAAIDYKSYGTEK    911 - 980
ACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKMVKHSNTLKPDSSRLENIKSWVLGAFALLCLLGLT    981 - 1050
WSFGLLFINEETIVMAYLFTIFNAFQGVFIFIFHCALQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKAS   1051 - 1120
TTRTSARYSSGTQSRIRRMWNDTVRKQSESSFISGDINSTSTLNQGMTGNYLLTNPLLRPHGTNNPYNTL   1121 - 1190
LAETVVCNAPSAPVFNSPGHSLNNARDTSAMDTLPLNGNFNNSYSLHKGDYNDSVQVVDCGLSLNDTAFE   1191 - 1260
KMIISELVHNNLRGSSKTHNLELTLPVKPVIGGSSSEDDAIVADASSLMHSDNPGLELHHKELEAPLIPQ   1261 - 1330
RTHSLLYQPQKKVKSEGTDSYVSQLTAEAEDHLQSPNRDSLYTSMPNLRDSPYPESSPDMEEDLSPSRRS   1331 - 1400
ENEDIYYKSMPNLGAGHQLQMCYQISRGNSDGYIIPINKEGCIPEGDVREGQMQLVTSL              1401 - 1459
//

Text Mined References (22)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22085899 2012 UGT1A1 is a major locus influencing bilirubin levels in African Americans.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
17456239 2007 Discovery of tissue-specific exons using comprehensive human exon microarrays.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
15066411 2004 The multiple actions of black widow spider toxins and their selective use in neurosecretion studies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11520923 2001 alpha-Latrotoxin and its receptors: neurexins and CIRL/latrophilins.
10994649 A family of heptahelical receptors with adhesion-like domains: a marriage between two super families.
10964907 2000 The calcium-independent receptor for alpha-latrotoxin from human and rodent brains interacts with members of the ProSAP/SSTRIP/Shank family of multidomain proteins.
10760572 2000 Genomic structure and expression profile of LPHH1, a 7TM gene variably expressed in breast cancer cell lines.
10030676 1998 Isolation and characterization of a human homologue of the latrophilin gene from a region of 1p31.1 implicated in breast cancer.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.