Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.73
PubTator Score 3.09

Knowledge Summary

Patent (859)

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 1963 6.2e-06
osteosarcoma 7766 2.5e-04
mucosa-associated lymphoid tissue lymphoma 473 2.6e-02
axial spondyloarthropathy 27 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
interleukin-7 receptor alpha deficiency 18 3.251 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
axial spondyloarthropathy 1.200 4.4e-02
mucosa-associated lymphoid tissue lympho... 1.549 2.6e-02
osteosarcoma -2.711 2.5e-04
tuberculosis -1.300 6.2e-06

Gene RIF (2)

AA Sequence

MATPRGLGALLLLLLLPTSGQEKPTEGPRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSDSCNVENLQRY      1 - 70
WLNYEAHLMKEGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQVMKDEDKPPDRVRLPKSLFRS     71 - 140
LPGNRSVVRLAVTILDIGPGTLFKGPRLGLGDGSGVLNNRLVGLSVGQMHVTKLAEPLEIVFSHQRPPPN    141 - 210
MTLTCVFWDVTKGTTGDWSSEGCSTEVRPEGTVCCCDHLTFFALLLRPTLDQSTVHILTRISQAGCGVSM    211 - 280
IFLAFTIILYAFLRLSRERFKSEDAPKIHVALGGSLFLLNLAFLVNVGSGSKGSDAACWARGAVFHYFLL    281 - 350
CAFTWMGLEAFHLYLLAVRVFNTYFGHYFLKLSLVGWGLPALMVIGTGSANSYGLYTIRDRENRTSLELC    351 - 420
WFREGTTMYALYITVHGYFLITFLFGMVVLALVVWKIFTLSRATAVKERGKNRKKVLTLLGLSSLVGVTW    421 - 490
GLAIFTPLGLSTVYIFALFNSLQGVFICCWFTILYLPSQSTTVSSSTARLDQAHSASQE               491 - 549
//

Text Mined References (12)

PMID Year Title