Property Summary

NCBI Gene PubMed Count 53
PubMed Score 100.63
PubTator Score 68.90

Knowledge Summary

Patent (6,463)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
POLYMICROGYRIA, BILATERAL FRONTOPARIETAL 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Multiple Sclerosis 527 0.0 0.8
Disease Target Count Z-score Confidence
Lissencephaly 69 4.332 2.2
Periventricular nodular heterotopia 30 4.267 2.1

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.600 5.7e-03
astrocytic glioma 1.500 3.9e-03
Astrocytoma, Pilocytic 1.600 1.3e-03
colon cancer 1.400 1.5e-02
Common variable immunodeficiency 1.175 1.5e-02
cystic fibrosis -1.490 1.7e-04
ependymoma 1.300 5.8e-03
glioblastoma 2.100 2.3e-04
group 3 medulloblastoma -1.400 1.3e-03
interstitial cystitis -1.100 1.9e-02
intraductal papillary-mucinous adenoma (... 1.800 5.2e-04
intraductal papillary-mucinous carcinoma... 1.200 2.3e-02
intraductal papillary-mucinous neoplasm ... 2.200 3.6e-04
oligodendroglioma 2.400 2.0e-03
osteosarcoma -1.909 3.5e-03
ovarian cancer 2.100 3.8e-07
pancreatic ductal adenocarcinoma liver m... 1.961 6.0e-03
psoriasis -1.700 7.3e-05
tuberculosis 1.200 3.5e-03
type I diabetes mellitus -1.184 2.1e-02

Pathway (1)

Gene RIF (35)

AA Sequence

MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAP      1 - 70
FPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSV     71 - 140
TSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQ    141 - 210
SLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGR    211 - 280
SGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWV    281 - 350
EDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV    351 - 420
TIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCL    421 - 490
SWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPS    491 - 560
MCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSF    561 - 630
ASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI           631 - 693
//

Text Mined References (59)

PMID Year Title