Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.01
PubTator Score 5.28

Knowledge Summary

Patent (5,629)

Expression

  Differential Expression (12)

Disease log2 FC p
esophageal adenocarcinoma -1.200 2.4e-02
head and neck cancer and chronic obstruc... -1.100 1.6e-02
interstitial cystitis -1.300 2.0e-02
intraductal papillary-mucinous neoplasm ... 3.700 7.8e-06
lung adenocarcinoma 2.300 1.2e-09
lung carcinoma -1.400 6.0e-08
nasopharyngeal carcinoma -2.300 1.2e-09
non-small cell lung carcinoma 1.700 1.7e-09
pancreatic cancer 1.300 1.3e-03
psoriasis 5.000 4.2e-237
spina bifida -2.929 4.6e-02
ulcerative colitis 1.700 1.0e-03

Gene RIF (5)

AA Sequence

MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLK      1 - 70
LLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNL     71 - 140
SQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRNGSIVA    141 - 210
GYEVVGSSSASELLSAIEHVAEKAKTALHKLFPLEDGSFRVFGKAQCNDIVFGFGSKDDEYTLPCSSGYR    211 - 280
GNITAKCESSGWQVIRETCVLSLLEELNKNFSMIVGNATEAAVSSFVQNLSVIIRQNPSTTVGNLASVVS    281 - 350
ILSNISSLSLASHFRVSNSTMEDVISIADNILNSASVTNWTVLLREEKYASSRLLETLENISTLVPPTAL    351 - 420
PLNFSRKFIDWKGIPVNKSQLKRGYSYQIKMCPQNTSIPIRGRVLIGSDQFQRSLPETIISMASLTLGNI    421 - 490
LPVSKNGNAQVNGPVISTVIQNYSINEVFLFFSKIESNLSQPHCVFWDFSHLQWNDAGCHLVNETQDIVT    491 - 560
CQCTHLTSFSILMSPFVPSTIFPVVKWITYVGLGISIGSLILCLIIEALFWKQIKKSQTSHTRRICMVNI    561 - 630
ALSLLIADVWFIVGATVDTTVNPSGVCTAAVFFTHFFYLSLFFWMLMLGILLAYRIILVFHHMAQHLMMA    631 - 700
VGFCLGYGCPLIISVITIAVTQPSNTYKRKDVCWLNWSNGSKPLLAFVVPALAIVAVNFVVVLLVLTKLW    701 - 770
RPTVGERLSRDDKATIIRVGKSLLILTPLLGLTWGFGIGTIVDSQNLAWHVIFALLNAFQGFFILCFGIL    771 - 840
LDSKLRQLLFNKLSALSSWKQTEKQNSSDLSAKPKFSKPFNPLQNKGHYAFSHTGDSSDNIMLTQFVSNE    841 - 910
//

Text Mined References (18)

PMID Year Title