Property Summary

NCBI Gene PubMed Count 59
PubMed Score 81.52
PubTator Score 67.04

Knowledge Summary

Patent (15,315)

Expression

Gene RIF (35)

PMID Text
26462154 Knock down of CD97 led to an altered mechanical phenotype, reduced adhesion to a stromal layer and lower wildtype FLT3 expression.
26107567 present study suggested that the expressions of CD97 antigen and decay accelerating factor(DAF) were both upregulated in human cervical squamous cell carcinoma
26034356 CD97 promotes gastric cancer cell proliferation and invasion in vitro through exosome-mediated MAPK signaling pathway, and exosomal miRNAs are probably involved in activation of the CD97-associated pathway.
25714433 we identify the specific isoforms of CD97, a novel pro-invasive glioma antigen, across histologic grades of glioma and within BTICs. We also demonstrate a trend towards increased CD97 expression among the classical and mesenchymal GBM subtypes.
25174588 CD97 enhanced TIMP-2 secretion, leading to reduced MT-MMP-1 and -2 activities, impairing cell migration/invasion in vitro and lung macrometastasis in vivo and upregulating integrins. Both the NTF and the CTF of CD97 were required.
24949957 We conclude that CD97 is located in the SR and at the peripheral sarcolemma of human and murine skeletal muscle, where its absence affects the structure of the SR without impairing skeletal muscle function
24274104 These results provide the first experimental evidence that cd97 is a direct target of miR-126.
23838008 Lysophosphatidylethanolamine utilizes LPA(1) and CD97 in a breast cancer cell line.
23771909 study reports gene expression in skeletal muscle tissue of women with metabolic syndrome is enriched in inflammatory response-related genes; IL6R, HDAC9 and CD97 expression correlated negatively with insulin sensitivity; suggests a role for these 3 inflammatory genes in development of skeletal muscle insulin resistance in women
23658650 CD97 expression promotes invasion and migration in glioblastoma multiforme, but has no effect on tumor proliferation.
22797060 CD97 expression in human thyroid cancers correlated with LPA receptor and markers of aggressiveness including Ki67 and pAKT.
22768192 CD97 small isoform not only supported gastric cancer local growth, but also promoted metastatic spread in orthotopically implanted mouse model.
22547928 CD97 and CD55 showed high expression at the invasive front of gallbladder carcinoma. CD97 and CD55 expression was associated with high histologic grade, advanced pathologic T stage, clinical stage and positive venous/lymphatic invasion.
22313360 we conclude that the possible upregulation of CD97 mediated by WT1 promotes cellular invasiveness-one of the most characteristic and challenging aspects of glial tumor cells.
22210915 binding of leukocytes to activated endothelium mediated by the interaction of CD97 with Thy-1 is involved in firm adhesion of polymorphonuclear cells during inflammation and may play a role in the regulation of leukocyte trafficking to inflammatory sites.
21978933 CD97 functioned to mediate invasion in prostate cancer cells, by associating with lysophosphatidic acid receptor 1 (LPAR1), leading to enhanced LPA-dependent RHO and extracellular signal-regulated kinase activation.
21156175 expression of the wild type - but not the GPS cleavage-deficient CD97 up-regulates the expression of N-cadherin, leading to Ca(++)-dependent cell-cell aggregation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20428763 the tumor promoting role of CD97 small isoform in cancer progression
20339853 Elevated expression of CD97 and its ligand CD55 at the invasion front correlate with tumor recurrence and metastasis, and CD95 may be a poor prognostic factor for rectal adenocarcinoma.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20167235 complex cellular expression programmes rather than activation modes regulate the expression of EGF-TM7 receptors in macrophages
19913121 Observational study of gene-disease association. (HuGE Navigator)
19737555 CD97-mFc can adopt two different conformations; one capable of auto-proteolysis and the other not.
19428565 CD97 is present on all lymphocytes in blood and lymphoid tissue. Expression of CD97 on B cells was lower compared to T and NK cells and did not differ between B-cell subsets.
18976975 Knockdown of CD97 molecule by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18329191 Sp1 and Sp3 over-expression activates CD97 promoter activity in HEK293 cells.
18267122 EGF-TM7 pre-mRNAs also undergo the rare trans-splicing, leading to the generation of functional chimeric receptors.
17449467 CD55 may simultaneously regulate both the innate and adaptive immune responses and can also regulate complement when bound to CD97.
16929497 enhanced CD97 expression in colorectal cancer cells is regulated independent of beta-catenin/Tcf-4, and is thus not a direct target of the canonical Wnt pathway
16818763 CD55 engagement with its natural ligand CD97 can act as a potent costimulator of human CD4+ T cells, resulting in cellular activation and promoting enhanced proliferation and cytokine secretion.
16273233 Findings suggest that CD97(EGF) may play a role in the development and invasion of gastric carcinomas.
15576472 coengagement of alpha5beta1 and chondroitotin sulfate proteoglycan by CD97 synergistically initiates endothelial cell invasion
12414513 CD97 expression correlates with dedifferentiation, migration, and invasion in colorectal tumor cell lines
11380941 CD97 is expressed in all types of macrophages and dendritic cells except for microglia, in most T cells but only a few B cells, in smooth muscle cells, and in a restricted set of thyroid and gastrointestinal carcinomas.

AA Sequence

MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTETCDDINECAT      1 - 70
PSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSY     71 - 140
TCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDV    141 - 210
DECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFD    211 - 280
KVQDLGRDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPF    281 - 350
TYISPSNTELTLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHS    351 - 420
KKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPR    421 - 490
QELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHYDVEDWKLTLITRVGLALSLF    491 - 560
CLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWM    561 - 630
SLEGLELYFLVVRVFQGQGLSTRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPV    631 - 700
TFIILCNAVIFVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYV    701 - 770
FTILNCLQGAFLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI         771 - 835
//

Text Mined References (67)

PMID Year Title
26462154 2015 Association of the EGF-TM7 receptor CD97 expression with FLT3-ITD in acute myeloid leukemia.
26107567 2015 Immunohistochemical Expression and Prognostic Significance of CD97 and its Ligand DAF in Human Cervical Squamous Cell Carcinoma.
26034356 2015 CD97 promotes gastric cancer cell proliferation and invasion through exosome-mediated MAPK signaling pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25714433 2015 Proportional upregulation of CD97 isoforms in glioblastoma and glioblastoma-derived brain tumor initiating cells.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
25174588 2014 CD97 inhibits cell migration in human fibrosarcoma cells by modulating TIMP-2/MT1- MMP/MMP-2 activity--role of GPS autoproteolysis and functional cooperation between the N- and C-terminal fragments.
24949957 2014 Skeletal muscle expression of the adhesion-GPCR CD97: CD97 deletion induces an abnormal structure of the sarcoplasmatic reticulum but does not impair skeletal muscle function.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24274104 2014 Prometastatic GPCR CD97 is a direct target of tumor suppressor microRNA-126.
23838008 2013 Lysophosphatidylethanolamine utilizes LPA(1) and CD97 in MDA-MB-231 breast cancer cells.
23771909 2013 Upregulation of skeletal muscle inflammatory genes links inflammation with insulin resistance in women with the metabolic syndrome.
23658650 2013 Overexpression of CD97 confers an invasive phenotype in glioblastoma cells and is associated with decreased survival of glioblastoma patients.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797060 2013 CD97 amplifies LPA receptor signaling and promotes thyroid cancer progression in a mouse model.
22768192 2012 The invasion and metastasis promotion role of CD97 small isoform in gastric carcinoma.
22547928 2012 Immunohistochemical expression and prognostic value of CD97 and its ligand CD55 in primary gallbladder carcinoma.
22313360 2012 Novel report of expression and function of CD97 in malignant gliomas: correlation with Wilms tumor 1 expression and glioma cell invasiveness.
22210915 2012 Thy-1 (CD90) is an interacting partner for CD97 on activated endothelial cells.
21978933 2011 LPA receptor heterodimerizes with CD97 to amplify LPA-initiated RHO-dependent signaling and invasion in prostate cancer cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21156175 2011 GPS autoproteolysis is required for CD97 to up-regulate the expression of N-cadherin that promotes homotypic cell-cell aggregation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20428763 2010 Role of CD97 isoforms in gastric carcinoma.
20339853 2010 The impact of expressions of CD97 and its ligand CD55 at the invasion front on prognosis of rectal adenocarcinoma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20167235 2010 Differential expression of the EGF-TM7 family members CD97 and EMR2 in lipid-laden macrophages in atherosclerosis, multiple sclerosis and Gaucher disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19737555 2009 Site-specific N-glycosylation regulates the GPS auto-proteolysis of CD97.
19428565 2009 Differential expression of CD97 on human lymphocyte subsets and limited effect of CD97 antibodies on allogeneic T-cell stimulation.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18329191 2008 Transcriptional regulation of the human CD97 promoter by Sp1/Sp3 in smooth muscle cells.
18267122 2008 Putative alternative trans-splicing of leukocyte adhesion-GPCR pre-mRNAs generates functional chimeric receptors.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17449467 2007 Structural and functional characterization of a novel T cell receptor co-regulatory protein complex, CD97-CD55.
16929497 2006 CD97 overexpression in tumor cells at the invasion front in colorectal cancer (CC) is independently regulated of the canonical Wnt pathway.
16818763 2006 Costimulation via CD55 on human CD4+ T cells mediated by CD97.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273233 2005 The expression of CD97EGF and its ligand CD55 on marginal epithelium is related to higher stage and depth of tumor invasion of gastric carcinomas.
15576472 2005 CD97, an adhesion receptor on inflammatory cells, stimulates angiogenesis through binding integrin counterreceptors on endothelial cells.
15498814 2005 Expression of the largest CD97 and EMR2 isoforms on leukocytes facilitates a specific interaction with chondroitin sulfate on B cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647991 2004 The EGF-TM7 family: a postgenomic view.
12829604 2003 The epidermal growth factor-like domains of the human EMR2 receptor mediate cell attachment through chondroitin sulfate glycosaminoglycans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417446 2002 Expression of the EGF-TM7 receptor CD97 and its ligand CD55 (DAF) in multiple sclerosis.
12414513 2002 Expression and regulation of CD97 in colorectal carcinoma cell lines and tumor tissues.
11380941 2001 Tissue distribution of the human CD97 EGF-TM7 receptor.
11297558 2001 Molecular analysis of the epidermal growth factor-like short consensus repeat domain-mediated protein-protein interactions: dissection of the CD97-CD55 complex.
11037979 2000 CD97 isoform expression in leukocytes.
10540231 1999 Structural characterization of mouse CD97 and study of its specific interaction with the murine decay-accelerating factor (DAF, CD55).
9764855 1998 Phenotypic characterization of human skin mast cells by combined staining with toluidine blue and CD antibodies.
9135025 1997 CD97: a dedifferentiation marker in human thyroid carcinomas.
9064337 1996 The seven-span transmembrane receptor CD97 has a cellular ligand (CD55, DAF).
8955192 1996 CD97 is a processed, seven-transmembrane, heterodimeric receptor associated with inflammation.
8786105 1996 Structure of the human CD97 gene: exon shuffling has generated a new type of seven-span transmembrane molecule related to the secretin receptor superfamily.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7636245 1995 Expression cloning and chromosomal mapping of the leukocyte activation antigen CD97, a new seven-span transmembrane molecule of the secretion receptor superfamily with an unusual extracellular domain.