Property Summary

NCBI Gene PubMed Count 33
PubMed Score 43.71
PubTator Score 38.14

Knowledge Summary

Patent (4,278)

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.600 4.7e-03
Breast cancer 2.800 2.5e-02
interstitial cystitis 1.700 4.5e-05
pediatric high grade glioma 1.400 5.8e-04
lung carcinoma -1.300 1.4e-14
ulcerative colitis 2.400 2.7e-06
head and neck cancer and chronic obstruc... 1.300 1.7e-03

Gene RIF (14)

PMID Text
26841242 We identified a previously unknown missense substitution in ADGRE2 which was predicted to result in the replacement of cysteine with tyrosine as the only nonsynonymous variant cosegregating with vibratory urticaria in two large kindreds.
26153037 Data suggest that blood neutrophils expressing CD11c antigen and EMR2 protein be considered as potential biomarkers for sepsis and systemic inflammatory response syndrome (SIRS), respectively.
22310662 Using the myeloid cell-restricted EMR2 receptor as a paradigm, we exam the mechanistic relevance of the subunit interaction and demonstrate a critical role for autoproteolysis in mediating receptor signaling and cell activation
22035891 a functional role for EMR2 in the modulation of neutrophil activation during inflammation.
21503828 High EMR2 is associated with invasive phenotype in glioblastoma.
21174063 The association of improved patient survival with higher nuclear expression levels identifies EMR2 as a potential biomarker in patients with invasive breast cancer.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20167235 complex cellular expression programmes rather than activation modes regulate the expression of EGF-TM7 receptors in macrophages
18267122 EGF-TM7 pre-mRNAs also undergo the rare trans-splicing, leading to the generation of functional chimeric receptors.
17928360 Here we demonstrate how the human-restricted adhesion-GPCR EMR2 regulates neutrophil responses by potentiating the effects of a number of proinflammatory mediators and show that the transmembrane region is critical for adhesion-GPCR function.
17174274 The results presented here further support the idea that EMR2 plays a role in the migration and adhesion of myeloid cells during cell differentiation, maturation, and activation.
15150276 Site-directed mutagenesis of the P(+1) cleavage site (Ser(518)) shows an absolute requirement of a Ser, Thr, or Cys residue for efficient proteolysis.
12860403 role of the extracellular stalk and the G protein-coupled receptor proteolysis site motif in EMR2 processing
12829604 epidermal growth factor-like domains of the human EMR2 receptor mediate cell attachment through chondroitin sulfate glycosaminoglycans

AA Sequence

MGGRVFLVFLAFCVWLTLPGAETQDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINE      1 - 70
CATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTL     71 - 140
GSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVC    141 - 210
EDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSR    211 - 280
FFDKVQDLGRDYKPGLANNTIQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSN    281 - 350
GLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLV    351 - 420
LEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQN    421 - 490
GCGHWATTGCSTIGTRDTSTICRCTHLSSFAVLMAHYDVQEEDPVLTVITYMGLSVSLLCLLLAALTFLL    491 - 560
CKAIQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEALYLFLTARN    561 - 630
LTVVNYSSINRFMKKLMFPVGYGVPAVTVAISAASRPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNL    631 - 700
VLFLVTLWILKNRLSSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAARVMAYLFTIINSLQ    701 - 770
GVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEMHTLSSSAKADTSKPSTVN                     771 - 823
//

Text Mined References (34)

PMID Year Title
26841242 2016 Vibratory Urticaria Associated with a Missense Variant in ADGRE2.
26153037 2015 Expression of CD11c and EMR2 on neutrophils: potential diagnostic biomarkers for sepsis and systemic inflammation.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
22575658 2012 Signaling property study of adhesion G-protein-coupled receptors.
22310662 2012 Activation of myeloid cell-specific adhesion class G protein-coupled receptor EMR2 via ligation-induced translocation and interaction of receptor subunits in lipid raft microdomains.
22035891 EMR2 receptor ligation modulates cytokine secretion profiles and cell survival of lipopolysaccharide-treated neutrophils.
21503828 2011 Epidermal growth factor module-containing mucin-like receptor 2 is a newly identified adhesion G protein-coupled receptor associated with poor overall survival and an invasive phenotype in glioblastoma.
21174063 2011 Leukocyte adhesion-GPCR EMR2 is aberrantly expressed in human breast carcinomas and is associated with patient survival.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20167235 2010 Differential expression of the EGF-TM7 family members CD97 and EMR2 in lipid-laden macrophages in atherosclerosis, multiple sclerosis and Gaucher disease.
19124473 2009 Functional cross-interaction of the fragments produced by the cleavage of distinct adhesion G-protein-coupled receptors.
18267122 2008 Putative alternative trans-splicing of leukocyte adhesion-GPCR pre-mRNAs generates functional chimeric receptors.
17928360 2008 Ligation of the adhesion-GPCR EMR2 regulates human neutrophil function.
17620333 2007 The role of receptor oligomerization in modulating the expression and function of leukocyte adhesion-G protein-coupled receptors.
17449467 2007 Structural and functional characterization of a novel T cell receptor co-regulatory protein complex, CD97-CD55.
17174274 2007 CD312, the human adhesion-GPCR EMR2, is differentially expressed during differentiation, maturation, and activation of myeloid cells.
17056209 2007 Identification of novel splice variants of Adhesion G protein-coupled receptors.
16918507 2006 Detection of novel leukocyte differentiation antigens on basophils and mast cells by HLDA8 antibodies.
15693006 2005 Identification of the epidermal growth factor-TM7 receptor EMR2 and its ligand dermatan sulfate in rheumatoid synovial tissue.
15498814 2005 Expression of the largest CD97 and EMR2 isoforms on leukocytes facilitates a specific interaction with chondroitin sulfate on B cells.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
15150276 2004 Autocatalytic cleavage of the EMR2 receptor occurs at a conserved G protein-coupled receptor proteolytic site motif.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647991 2004 The EGF-TM7 family: a postgenomic view.
12860403 2003 Proteolytic cleavage of the EMR2 receptor requires both the extracellular stalk and the GPS motif.
12829604 2003 The epidermal growth factor-like domains of the human EMR2 receptor mediate cell attachment through chondroitin sulfate glycosaminoglycans.
12761622 2003 Detection of alternatively spliced EMR2 mRNAs in colorectal tumor cell lines but rare expression of the molecule in colorectal adenocarcinomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12428789 2002 CD97, but not its closely related EGF-TM7 family member EMR2, is expressed on gastric, pancreatic, and esophageal carcinomas.
11994511 2002 The human EGF-TM7 family member EMR2 is a heterodimeric receptor expressed on myeloid cells.
11297558 2001 Molecular analysis of the epidermal growth factor-like short consensus repeat domain-mediated protein-protein interactions: dissection of the CD97-CD55 complex.
10903844 2000 Human EMR2, a novel EGF-TM7 molecule on chromosome 19p13.1, is closely related to CD97.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.