Property Summary

NCBI Gene PubMed Count 14
PubMed Score 18.66
PubTator Score 20.83

Knowledge Summary

Patent (3,703)

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer -1.500 7.2e-05
adult high grade glioma 1.400 8.6e-04
atypical teratoid / rhabdoid tumor 1.100 1.8e-04
cutaneous lupus erythematosus 1.500 1.6e-02
glioblastoma 1.300 1.5e-04
lung adenocarcinoma -1.800 1.5e-16
lung carcinoma -1.900 7.6e-10
malignant mesothelioma -5.500 1.5e-08
medulloblastoma, large-cell 1.400 9.9e-05
non-small cell lung cancer -1.702 1.7e-17
osteosarcoma -2.565 1.5e-05
psoriasis 1.300 2.9e-16
uncontrolled asthma 1.100 1.6e-02

Gene RIF (4)

AA Sequence

MRGFNLLLFWGCCVMHSWEGHIRPTRKPNTKGNNCRDSTLCPAYATCTNTVDSYYCACKQGFLSSNGQNH      1 - 70
FKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSS     71 - 140
VCPEHSDCVNSMGSYSCSCQVGFISRNSTCEDVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHL    141 - 210
SFQGLKASCEDIDECTEMCPINSTCTNTPGSYFCTCHPGFAPSNGQLNFTDQGVECRDIDECRQDPSTCG    211 - 280
PNSICTNALGSYSCGCIAGFHPNPEGSQKDGNFSCQRVLFKCKEDVIPDNKQIQQCQEGTAVKPAYVSFC    281 - 350
AQINNIFSVLDKVCENKTTVVSLKNTTESFVPVLKQISTWTKFTKEETSSLATVFLESVESMTLASFWKP    351 - 420
SANITPAVRTEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVL    421 - 490
NERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGG    491 - 560
RWTSFGCVILEASETYTICSCNQMANLAVIMASGELTMDFSLYIISHVGIIISLVCLVLAIATFLLCRSI    561 - 630
RNHNTYLHLHLCVCLLLAKTLFLAGIHKTDNKMGCAIIAGFLHYLFLACFFWMLVEAVILFLMVRNLKVV    631 - 700
NYFSSRNIKMLHICAFGYGLPMLVVVISASVQPQGYGMHNRCWLNTETGFIWSFLGPVCTVIVINSLLLT    701 - 770
WTLWILRQRLSSVNAEVSTLKDTRLLTFKAFAQLFILGCSWVLGIFQIGPVAGVMAYLFTIINSLQGAFI    771 - 840
FLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG                            841 - 886
//

Text Mined References (17)

PMID Year Title