Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.45
PubTator Score 15.15

Knowledge Summary

Patent (2,619)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -1.200 1.2e-19
glioblastoma multiforme -1.200 4.4e-17
oligodendroglioma -1.300 4.1e-19
ependymoma -1.100 7.2e-05
medulloblastoma -1.900 1.5e-04
atypical teratoid / rhabdoid tumor -1.500 6.5e-05
medulloblastoma, large-cell -3.000 1.3e-05
primitive neuroectodermal tumor -1.500 7.1e-04
active Crohn's disease 1.031 1.1e-02
adult high grade glioma -1.500 6.7e-04
Breast cancer 1.200 1.9e-06
pituitary cancer 2.000 1.7e-06

Gene RIF (4)

PMID Text
21787750 This is the first study reporting BAI2 as an interaction partner of GIP.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20367554 BAI2 is a functional GPCR regulated by proteolytic processing and activates the NFAT pathway
12218411 involvement of BAI2 in the ischemia-induced brain angiogenesis

AA Sequence

MENTGWMGKGHRMTPACPLLLSVILSLRLATAFDPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLE      1 - 70
NPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQAESEVGRPEEEEAEAAAGLE     71 - 140
LCSGSGPFTFLHFDKNFVQLCLSAEPSEAPRLLAPAALAFRFVEVLLINNNNSSQFTCGVLCRWSEECGR    141 - 210
AAGRACGFAQPGCSCPGEAGAGSTTTTSPGPPAAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRYG    211 - 280
EEPEEEPKVKTQWPRSADEPGLYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPLR    281 - 350
ETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAACPVEG    351 - 420
QWLEWGPWGPCSTSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKT    421 - 490
CDTGWQRRFRMCQATGTQGYPCEGTGEEVKPCSEKRCPAFHEMCRDEYVMLMTWKKAAAGEIIYNKCPPN    491 - 560
ASGSASRRCLLSAQGVAYWGLPSFARCISHEYRYLYLSLREHLAKGQRMLAGEGMSQVVRSLQELLARRT    561 - 630
YYSGDLLFSVDILRNVTDTFKRATYVPSADDVQRFFQVVSFMVDAENKEKWDDAQQVSPGSVHLLRVVED    631 - 700
FIHLVGDALKAFQSSLIVTDNLVISIQREPVSAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSS    701 - 770
PGKPATSGAAGSPGRGRGPGTVPPGPGHSHQRLLPADPDESSYFVIGAVLYRTLGLILPPPRPPLAVTSR    771 - 840
VMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASWDYSRADASSGDWDTENCQTLETQAAHTRCQCQH    841 - 910
LSTFAVLAQPPKDLTLELAGSPSVPLVIGCAVSCMALLTLLAIYAAFWRFIKSERSIILLNFCLSILASN    911 - 980
ILILVGQSRVLSKGVCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRKRFLCLGWGLPALVV    981 - 1050
AVSVGFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNKLMARDGISDKSKKQRAGSE   1051 - 1120
RCPWASLLLPCSACGAVPSPLLSSASARNAMASLWSSCVVLPLLALTWMSAVLAMTDRRSVLFQALFAVF   1121 - 1190
NSAQGFVITAVHCFLRREVQDVVKCQMGVCRADESEDSPDSCKNGQLQILSDFEKDVDLACQTVLFKEVN   1191 - 1260
TCNPSTITGTLSRLSLDEDEEPKSCLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEG   1261 - 1330
GLRQLDLTWLRPTEPGSEGDYMVLPRRTLSLQPGGGGGGGEDAPRARPEGTPRRAAKTVAHTEGYPSFLS   1331 - 1400
VDHSGLGLGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKMGSLERKKLRYSDLD   1401 - 1470
FEKVMHTRKRHSELYHELNQKFHTFDRYRSQSTAKREKRWSVSSGGAAERSVCTDKPSPGERPSLSQHRR   1471 - 1540
HQSWSTFKSMTLGSLPPKPRERLTLHRAAAWEPTEPPDGDFQTEV                            1541 - 1585
//

Text Mined References (18)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
21787750 2011 Identification of brain-specific angiogenesis inhibitor 2 as an interaction partner of glutaminase interacting protein.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20367554 2010 Brain-specific angiogenesis inhibitor 2 (BAI2) may be activated by proteolytic processing.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16412436 2006 Brain-specific angiogenesis inhibitor 2 regulates VEGF through GABP that acts as a transcriptional repressor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225653 2004 Expression of brain-specific angiogenesis inhibitor 3 (BAI3) in normal brain and implications for BAI3 in ischemia-induced brain angiogenesis and malignant glioma.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697242 2004 Chromosome 13q12 encoded Rho GTPase activating protein suppresses growth of breast carcinoma cells, and yeast two-hybrid screen shows its interaction with several proteins.
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
12508107 2003 Functional interaction of megalin with the megalinbinding protein (MegBP), a novel tetratrico peptide repeat-containing adaptor molecule.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218411 2002 Expression of brain-specific angiogenesis inhibitor 2 (BAI2) in normal and ischemic brain: involvement of BAI2 in the ischemia-induced brain angiogenesis.
10964907 2000 The calcium-independent receptor for alpha-latrotoxin from human and rodent brains interacts with members of the ProSAP/SSTRIP/Shank family of multidomain proteins.
9533023 1997 Cloning and characterization of BAI2 and BAI3, novel genes homologous to brain-specific angiogenesis inhibitor 1 (BAI1).