Property Summary

NCBI Gene PubMed Count 24
PubMed Score 41.19
PubTator Score 33.07

Knowledge Summary

Patent (3,890)

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 2.0e-05
adult high grade glioma -1.200 2.1e-03
posterior fossa group A ependymoma -1.400 1.9e-10
psoriasis -1.500 1.2e-33

Gene RIF (12)

PMID Text
26710850 Data suggest agonist-induced signal transduction via either BAI1/ADGRB1 or GPR56/ADGRG1 does not require conserved membrane-proximal stalk region; thus, it appears GAIN domain cleavage via autoproteolysis is not necessary for receptor activation.
26129954 BAI1 may be involved in the negative regulation of bladder transitional cell carcinoma microvascular proliferation, and its expression may be associated with a reduction in p53 mutations.
25376607 Results show that lower BAI1 expression correlates with poorer patient survival, and high Nestin expression is associated with an increased probability of metastases in breast cancer patients.
24509909 recognition of apoptotic cells by BAI1 contributes to their clearance in the human gastric mucosa and this is associated with anti-inflammatory effects
23782696 findings demonstrate that BAI1 is a synaptic receptor that can activate both the Rho and ERK pathways, with the N-terminal and C-terminal regions of the receptor playing key roles in the regulation of BAI1 signaling activity
23595754 The results of this study indicated that BAI1 plays an important role in synaptogenesis that is mechanistically distinct from its role in phagocytosis.
23190742 LRRK2 kinase inhibition suppresses HIV-1 Tat-induced upregulation of phosphatidylserine receptor BAI1 in microglia cells
22330140 Proprotein convertases, primarily furin, activate latent matrix metalloproteinase-14, which then directly cleaves BAI1 to release the bioactive fragment.
21724586 MBD2 overexpression during gliomagenesis may drive tumor growth by suppressing the antiangiogenic activity of a key tumor BAI1.
12507886 BAI1 was widely expressed in normal brain but was absent in 28 glioma cell lines and in the majority of human glioblastoma investigated. BAI1 expression did not correlate with TP53 status
12074842 BAI1 was expressed in cerebral neurons but not astrocytes. It was localized in the cytoplasm and cell membrane. BAI1 protein may play an important role in synapse formation and signal transduction
11875720 brain-specific angiogenesis inhibitor 1 over-expression suppresses tumour angiogenesis

AA Sequence

MRGQAAAPGPVWILAPLLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAVFPANASRCSW      1 - 70
TLRNPDPRRYTLYMKVAKAPVPCSGPGRVRTYQFDSFLESTRTYLGVESFDEVLRLCDPSAPLAFLQASK     71 - 140
QFLQMRRQQPPQHDGLRPRAGPPGPTDDFSVEYLVVGNRNPSRAACQMLCRWLDACLAGSRSSHPCGIMQ    141 - 210
TPCACLGGEAGGPAAGPLAPRGDVCLRDAVAGGPENCLTSLTQDRGGHGATGGWKLWSLWGECTRDCGGG    211 - 280
LQTRTRTCLPAPGVEGGGCEGVLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAP    281 - 350
QTGDPAAEEWSPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSL    351 - 420
CSSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSACSASCSQGRQQR    421 - 490
TRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGAGSQRRERVCSGPFFGGAACQ    491 - 560
GPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVAAVRCPRNATGLILRRCELDEEGIAYWEPPT    561 - 630
YIRCVSIDYRNIQMMTREHLAKAQRGLPGEGVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRA    631 - 700
YYSPTPGDVQNFVQILSNLLAEENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYQVTDNLV    701 - 770
LSIHKLPASGATDISFPMKGWRATGDWAKVPEDRVTVSKSVFSTGLTEADEASVFVVGTVLYRNLGSFLA    771 - 840
LQRNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMYNGTTNQTCILWDETDVPSSSAPPQLGPWSWRGCR    841 - 910
TVPLDALRTRCLCDRLSTFAILAQLSADANMEKATLPSVTLIVGCGVSSLTLLMLVIIYVSVWRYIRSER    911 - 980
SVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHFFFLSSFCWVLTEAWQSYMAVTGHLRNRLIR    981 - 1050
KRFLCLGWGLPALVVAISVGFTKAKGYSTMNYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSK   1051 - 1120
DGITDKKLKERAGASLWSSCVVLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRRE   1121 - 1190
VQDAVKCRVVDRQEEGNGDSGGSFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPSLPE   1191 - 1260
EEKLKLAHAKGPPTNFNSLPANVSKLHLHGSPRYPGGPLPDFPNHSLTLKRDKAPKSSFVGDGDIFKKLD   1261 - 1330
SELSRAQEKALDTSYVILPTATATLRPKPKEEPKYSIHIDQMPQTRLIHLSTAPEASLPARSPPSRQPPS   1331 - 1400
GGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDPGEPAAHPGPSTGPSTKNENVATLSVSSL   1401 - 1470
ERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHAAEKDKEVLGPDSKPEKQQTPNKRPWESLRKAHGT   1471 - 1540
PTWVKKELEPLQPSPLELRSVEWERSGATIPLVGQDIIDLQTEV                             1541 - 1584
//

Text Mined References (29)

PMID Year Title
26710850 2016 Stalk-dependent and Stalk-independent Signaling by the Adhesion G Protein-coupled Receptors GPR56 (ADGRG1) and BAI1 (ADGRB1).
26129954 2015 Expression of brain?specific angiogenesis inhibitor?1 and association with p53, microvessel density and vascular endothelial growth factor in the tissue of human bladder transitional cell carcinoma.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
25376607 2015 Changes in BAI1 and nestin expression are prognostic indicators for survival and metastases in breast cancer and provide opportunities for dual targeted therapies.
24509909 2014 Brain angiogenesis inhibitor 1 is expressed by gastric phagocytes during infection with Helicobacter pylori and mediates the recognition and engulfment of human apoptotic gastric epithelial cells.
23782696 2013 Brain-specific angiogenesis inhibitor-1 signaling, regulation, and enrichment in the postsynaptic density.
23595754 2013 The adhesion-GPCR BAI1 regulates synaptogenesis by controlling the recruitment of the Par3/Tiam1 polarity complex to synaptic sites.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22333914 2012 A novel evolutionarily conserved domain of cell-adhesion GPCRs mediates autoproteolysis.
22330140 2012 A proprotein convertase/MMP-14 proteolytic cascade releases a novel 40?kDa vasculostatin from tumor suppressor BAI1.
21724586 2011 Overexpression of MBD2 in glioblastoma maintains epigenetic silencing and inhibits the antiangiogenic function of the tumor suppressor gene BAI1.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
14980512 2004 Extracellular fragment of brain-specific angiogenesis inhibitor 1 suppresses endothelial cell proliferation by blocking alphavbeta5 integrin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
12507886 2003 Brain angiogenesis inhibitor 1 is differentially expressed in normal brain and glioblastoma independently of p53 expression.
12074842 2002 Brain-specific angiogenesis inhibitor 1 (BAI1) is expressed in human cerebral neuronal cells.
11937501 2002 Selectivity and promiscuity of the first and second PDZ domains of PSD-95 and synapse-associated protein 102.
11875720 2002 Overexpression of the p53-inducible brain-specific angiogenesis inhibitor 1 suppresses efficiently tumour angiogenesis.
11245925 2001 Characterization of mouse brain-specific angiogenesis inhibitor 1 (BAI1) and phytanoyl-CoA alpha-hydroxylase-associated protein 1, a novel BAI1-binding protein.
10748157 2000 Interaction of the tumor suppressor PTEN/MMAC with a PDZ domain of MAGI3, a novel membrane-associated guanylate kinase.
10343108 1999 Identification of BAIAP2 (BAI-associated protein 2), a novel human homologue of hamster IRSp53, whose SH3 domain interacts with the cytoplasmic domain of BAI1.
9790924 1998 Cloning and characterization of BAP3 (BAI-associated protein 3), a C2 domain-containing protein that interacts with BAI1.
9772287 1998 Brain-specific angiogenesis inhibitor 1 expression is inversely correlated with vascularity and distant metastasis of colorectal cancer.
9647739 1998 Cloning and characterization of BAI-associated protein 1: a PDZ domain-containing protein that interacts with BAI1.
9533023 1997 Cloning and characterization of BAI2 and BAI3, novel genes homologous to brain-specific angiogenesis inhibitor 1 (BAI1).
9393972 1997 A novel brain-specific p53-target gene, BAI1, containing thrombospondin type 1 repeats inhibits experimental angiogenesis.
7531056 1994 Release of an inhibitor of angiogenesis upon induction of wild type p53 expression in glioblastoma cells.