Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.72
PubTator Score 8.05

Knowledge Summary

Patent (1,942)

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.800 1.5e-02
sonic hedgehog group medulloblastoma 1.200 1.4e-03
medulloblastoma, large-cell 1.700 7.0e-06
lung cancer 2.400 8.0e-05
non primary Sjogren syndrome sicca -1.100 2.7e-02
invasive ductal carcinoma -1.092 1.0e-03
lung adenocarcinoma 1.042 1.0e-03
non-inflammatory breast cancer -1.200 5.6e-03
ulcerative colitis -1.500 5.0e-06
ovarian cancer 1.400 2.3e-03

Gene RIF (3)

PMID Text
24902969 ID4 and GPR125 are expressed on partially overlapping spermatogonial populations and are more broadly expressed in normal adult human testis. ID4 and GPR125 could be used for identifying previously unrecognized human spermatogonial subpopulations
20677014 Observational study of gene-disease association. (HuGE Navigator)
17457313 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPPGRRRGRAQPPLLLPLSLLALLALLGGGGGGGAAALPAGCKHDGRPRGAGRAAGAAEGKVVCSSLEL      1 - 70
AQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNNLISSIDPGAFWGLSSLKRLDLTNNR     71 - 140
IGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSLEFQTEYLLCDCNILWMHRWVKEKNITVR    141 - 210
DTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQD    211 - 280
GRIVETDESQGIFVEKNMIHNCSLIASALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYCP    281 - 350
PERVVNNKGDFRWPRTLAGITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDV    351 - 420
TRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIA    421 - 490
SNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEAYVIKSTGFTGMTCTVF    491 - 560
QKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSLALKNTIVEASIQLPPSLFSPKQKRELRPTD    561 - 630
DSLYKLQLIAFRNGKLFPATGNSTNLADDGKRRTVVTPVILTKIDGVNVDTHHIPVNVTLRRIAHGADAV    631 - 700
AARWDFDLLNGQGGWKSDGCHILYSDENITTIQCYSLSNYAVLMDLTGSELYTQAASLLHPVVYTTAIIL    701 - 770
LLCLLAVIVSYIYHHSLIRISLKSWHMLVNLCFHIFLTCVVFVGGITQTRNASICQAVGIILHYSTLATV    771 - 840
LWVGVTARNIYKQVTKKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNYGSRPNAPYCW    841 - 910
MAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRLAANENGEINHQDSMSLSL    911 - 980
ISTSALENEHTFHSQLLGASLTLLLYVALWMFGALAVSLYYPLDLVFSFVFGATSLSFSAFFVVHHCVNR    981 - 1050
EDVRLAWIMTCCPGRSSYSVQVNVQPPNSNGTNGEAPKCPNSSAESSCTNKSASSFKNSSQGCKLTNLQA   1051 - 1120
AAAQCHANSLPLNSTPQLDNSLTEHSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREY   1121 - 1190
AYDVPTSVEGSVQNGLPKSRLGNNEGHSRSRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTT   1191 - 1260
SKKDALRKPAVVELENQQKSYGLNLAIQNGPIKSNGQEGPLLGTDSTGNVRTGLWKHETTV            1261 - 1321
//

Text Mined References (13)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
24902969 2014 Evaluation of candidate spermatogonial markers ID4 and GPR125 in testes of adult human cadaveric organ donors.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
17457313 2007 Association analysis of the chromosome 4p15-p16 candidate region for bipolar disorder and schizophrenia.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
15021905 2004 Direct binding of the human homologue of the Drosophila disc large tumor suppressor gene to seven-pass transmembrane proteins, tumor endothelial marker 5 (TEM5), and a novel TEM5-like protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12565841 2003 There exist at least 30 human G-protein-coupled receptors with long Ser/Thr-rich N-termini.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.