Property Summary

NCBI Gene PubMed Count 30
PubMed Score 78.91
PubTator Score 20.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
Rheumatoid Arthritis 1.300 4.7e-03
Waldenstrons macroglobulinemia 1.763 1.5e-02
psoriasis 1.400 2.5e-03
osteosarcoma 1.770 3.3e-04
glioblastoma -1.900 3.3e-03
sonic hedgehog group medulloblastoma -2.200 3.5e-08
medulloblastoma, large-cell -2.400 4.6e-06
Crohn's disease -1.137 3.2e-02
ulcerative colitis -1.328 1.3e-02
Duchenne muscular dystrophy 1.674 1.5e-06
autosomal dominant Emery-Dreifuss muscul... 1.476 1.1e-02
fascioscapulohumeral muscular dystrophy 1.003 2.3e-03
juvenile dermatomyositis 1.491 5.9e-10
Amyotrophic Lateral Sclerosis 1.001 9.7e-05
acute quadriplegic myopathy 1.093 1.9e-03
Atopic dermatitis -1.100 5.2e-04
primary pancreatic ductal adenocarcinoma 1.207 2.7e-02
intraductal papillary-mucinous adenoma (... 1.900 2.1e-05
lung cancer 1.700 6.4e-04
aldosterone-producing adenoma -1.183 3.1e-02
lung adenocarcinoma -1.200 1.6e-06
Breast cancer -2.000 2.8e-06
breast carcinoma -1.500 2.6e-29
spina bifida -1.580 4.0e-02
Pick disease 1.100 2.8e-04
invasive ductal carcinoma -1.700 3.6e-03
ovarian cancer -1.900 1.7e-08
Down syndrome 1.700 2.9e-03
pancreatic cancer 1.100 3.0e-02
dermatomyositis 1.200 7.7e-03

Gene RIF (21)

PMID Text
25285724 ADD3 gene plays an important role in biliary atresia pathogenesis.
24104524 ADD3 gene may be functionally relevant for the development of biliary atresia
23872602 Common genetic variants in 10q24.2 can alter biliary atresia risk by regulating ADD3 expression levels in the liver, and may exert an effect on disease epidemiology and on the general population.
23836506 Homozygous p.G367D mutation in ADD3 causes spastic diplegic/quadriplegic cerebral palsy and intellectual disability.
23814265 High expression of ADD3 is associated with glioma.
23333304 HIV-1 Vif downregulates the expression of adducin 3 protein gamma (ADD3) in Vif-expression T cells
21164023 gamma-adducin may influence blood pressure homeostasis by modulating renal NaCl transport.
20810786 These findings suggest novel roles for adducins in stabilization of epithelial junctions and regulation of junctional remodeling.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18787518 In ADD1 GlyGly homozygotes, the properties of the brachial artery are related to the ADD3 (A386G) polymorphism, but the underlying mechanism needs further clarification.
18787518 Observational study of gene-disease association. (HuGE Navigator)
18667944 Observational study of gene-disease association. (HuGE Navigator)
18475162 Left ventricular diastolic relaxation is modulated by genetic variation in ADD3.
18475162 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
15963851 The early expression of ADD3 suggests that it may have a role in erythroblasts but is replaced by ADD2 in later stages of erythropoiesis.
15834281 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15716695 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15716695 The interaction of ADD1 and ADD3 gene variants in humans is statistically associated with variation in blood pressure, suggesting the presence of epistatic effects among these loci.

AA Sequence

MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFRED      1 - 70
LECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTSSYVKGEKLTRCK     71 - 140
LASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNLKIDH    141 - 210
TGFSPHAAIYSTRPDVKCVIHIHTLATAAVSSMKCGILPISQESLLLGDVAYYDYQGSLEEQEERIQLQK    211 - 280
VLGPSCKVLVLRNHGVVALGETLEEAFHYIFNVQLACEIQVQALAGAGGVDNLHVLDFQKYKAFTYTVAA    281 - 350
SGGGGVNMGSHQKWKVGEIEFEGLMRTLDNLGYRTGYAYRHPLIREKPRHKSDVEIPATVTAFSFEDDTV    351 - 420
PLSPLKYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDSSKVSGGTPIKIEDPNQ    421 - 490
FVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQFEDDDHGPPAPPNPFSHLTEG    491 - 560
ELEEYKRTIERKQQGLEDAEQELLSDDASSVSQIQSQTQSPQNVPEKLEENHELFSKSFISMEVPVMVVN    561 - 630
GKDDMHDVEDELAKRVSRLSTSTTIENIEITIKSPEKIEEVLSPEGSPSKSPSKKKKKFRTPSFLKKNKK    631 - 700
KEKVEA                                                                    701 - 706
//

Text Mined References (41)

PMID Year Title
25285724 2014 Association between single nucleotide polymorphisms in the ADD3 gene and susceptibility to biliary atresia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24104524 2014 Replication of a GWAS signal in a Caucasian population implicates ADD3 in susceptibility to biliary atresia.
23872602 2013 Common genetic variants regulating ADD3 gene expression alter biliary atresia risk.
23836506 2013 Mutations in ? adducin are associated with inherited cerebral palsy.
23814265 2013 MiR-145 functions as a tumor-suppressive RNA by targeting Sox9 and adducin 3 in human glioma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21164023 2011 ?-Adducin stimulates the thiazide-sensitive NaCl cotransporter.
20810786 2010 Adducins regulate remodeling of apical junctions in human epithelial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20460270 2010 Genome-wide association study identifies a susceptibility locus for biliary atresia on 10q24.2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18787518 2009 Arterial properties in relation to genetic variations in the adducin subunits in a white population.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18667944 2008 Gly460Trp alpha-adducin mutation as a possible mechanism leading to endolymphatic hydrops in Ménière's syndrome.
18475162 2008 Effects of genetic variation in adducin on left ventricular diastolic function as assessed by tissue Doppler imaging in a Flemish population.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15963851 2005 Expression of adducin genes during erythropoiesis: a novel erythroid promoter for ADD2.
15834281 2005 Epistatic interaction between alpha- and gamma-adducin influences peripheral and central pulse pressures in white Europeans.
15716695 2005 Role of the adducin family genes in human essential hypertension.
15561718 2005 Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11895774 2002 Adducin in platelets: activation-induced phosphorylation by PKC and proteolysis by calpain.
10581174 1999 Genomic organization of the human gamma adducin gene.
10485892 1999 Targeted disruption of the beta adducin gene (Add2) causes red blood cell spherocytosis in mice.
8893809 1996 Cloning, expression and chromosome mapping of adducin-like 70 (ADDL), a human cDNA highly homologous to human erythrocyte adducin.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2503523 1989 Adducin: Ca++-dependent association with sites of cell-cell contact.