Property Summary

NCBI Gene PubMed Count 72
PubMed Score 81.37
PubTator Score 168.00

Knowledge Summary

Patent (19,732)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 3.500 3.5e-03
ependymoma 3.300 4.9e-04
oligodendroglioma 3.300 3.1e-04
sonic hedgehog group medulloblastoma -2.400 1.6e-06
atypical teratoid / rhabdoid tumor -2.700 2.9e-05
medulloblastoma, large-cell -2.200 8.1e-06
intraductal papillary-mucinous adenoma (... -1.200 1.9e-03
subependymal giant cell astrocytoma -1.583 2.8e-02
invasive ductal carcinoma -1.800 1.3e-04
ductal carcinoma in situ -1.400 9.7e-05
ovarian cancer 1.800 6.6e-05
psoriasis -1.400 1.1e-53

Gene RIF (44)

PMID Text
26343289 Data show that glucocorticoid response genes NR3C1, ADCYAP1R1 and HSD11B2 were relatively hypomethylated whereas FKBP5 was hypermethylated.
26334183 Further investigations of genetic factors for trauma-related psychopathology should include careful assessments of the social environment
25918834 High child stress and an ADCYAP1R1 single-nucleotide polymorphism are associated with reduced bronchodilator response in children with asthma.
25680674 Rsults suggest that impaired contextual conditioning in the hippocampal formation may mediate the association between type I receptor of the pituitary adenylate cyclase activating polypeptideand and posttraumatic stress disorder symptoms.
24696141 PAC1/PACAP receptor endocytosis contributes to ERK acktivation.
24516127 Individual differences in ADCYAP1R1 genotype may contribute to dysregulated fear circuitry known to play a central role in posttraumatic stress disorder and other anxiety disorders.
24220567 This review focuses on role of PAC1 receptor in brain development, behavior of transgenic animals and potential implication in human neurodevelopmental disorders.
23981011 association of variants with sudden infant death not supported
23972788 and its receptor (PAC1) are involved in stress response and anxiety.
23818986 Data indicate that VIP and PACAP increased macrophage resistance to HIV-1 replication by inducing the synthesis of beta-chemokines CCL3 and CCL5 and IL-10 following preferential activation of the receptors VPAC2 and PAC1.
23505260 ADCYAP1R1 genotype may have a role in post-traumatic stress symptoms in highly traumatized African-American females
23394710 The findings suggest that the PACAP-PAC1 receptor pathway may play an important role in female human responses to traumatic stress
23328528 Epigenetic and genetic variants in ADVYAP1R1 are associated with asthma in Puerto Rican children.
23280952 Genetic variation at the ADCYAP1R1 locus interacts with child abuse to shape risk of later posttraumatic stress disorder (PTSD) in women.
23147486 [review] The Adcyap1r1 receptor single nucleotide polymorphism (SNP) is located within a predicted estrogen response element (ERE).
22961270 Conclude that VPAC2/PAC1 receptors require NO in series to effect cutaneous active vasodilation during heat stress in humans.
22776899 PAC1 receptor (ADCYAP1R1) genotype is associated with dark-enhanced startle in both male and female children.
22609358 Activation of Sp1 by the Ras/MAPK pathway might participate in neuron specific expression of the PAC1 gene.
22581436 PAC1 regulates PYK-2 tyrosine phosphorylation in a calcium-dependent manner in lung cancer cell lines.
22539193 The increased expressions of PAC1 receptors on lactating breast may indicate a PACAP38/PAC1 interaction in the mammary gland during lactation.
21912390 A reported association between rs2267735 and PTSD could not be replicated in either African American or European American females in two large independent samples.
21350482 data suggest that perturbations in the PACAP-PAC1 pathway are involved in abnormal stress responses underlying post-traumatic stress disorder
21185349 The present study constitutes the first characterization of the binding domains of PACAP to its specific receptor PAC1 and suggests heterogeneity within the binding mode of peptide ligands to class B GPCRs.
20395540 VPAC2 and/or PAC1 receptor activation is involved in cutaneous active vasodilation in humans.
20026142 Results indicate that VPAC1, but not VPAC2 or PAC1, up-regulation in macrophages is a common mechanism in response to acute and chronic pro-inflammatory stimuli.
19926922 LH causes a transient stimulation of PACAP & PAC(1)-R expression & PACAP stimulates progesterone production in human luteinized granulosa cells, suggesting possible role of PACAP as a local ovarian regulator in luteinization.
19269029 a novel mechanism of calmodulin in regulating PACAP signaling by possible interaction with the inactive state of PAC1 and VPAC2 receptors.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18353507 Novel stable PACAP analogs with potent activity towards the PAC1 receptor are reported.
17470806 structure of the N-terminal EC domain of the hPAC1-RS receptor in complex with the PACAP (6'-38') peptide antagonist; identified hormone residues that are critical for binding to the N-terminal EC domain of PAC1-RS
16888199 PACAP may regulate the biological release of peptides and serotonin from BON cells
16823490 Data demonstrate that altered neuronal proliferation/apoptosis and disrupted ependymal cilia are the main factors contributing to hydrocephalus in PAC1-overexpressing mice.
16572459 PAC1-R is the predominant PACAP receptor found in fetuses, and both PAC1-R and VPAC1-R are expressed in the mature cerebellum.
16401644 Stimulation of endogenously expressed PAC1 receptors with PACAP in human neuroblastoma cells increased APPsalpha secretion. PAC1R activation stimulates ERK phosphorylation.
16372333 PAC(1)-R null variant is the most relevant isoform expressed in human prostaste cancer, and may be related with the events determining the outcome of prostate cancer.
16226889 Results show that the combination of different amino terminal and intracellular loop 3 splicing variants in the PAC1 receptor dictates the ability of agonists, including PACAP and VIP, to activate signaling pathways.
15518890 PACAP, PACAP receptor and tyrosine hydroxylase (TH) mRNAs in neuroblastomas
14742913 In colon cancer cell lines, PAC1 is expressed as the SV1 or HIP splice variant and is coupled to the activation only of cAMP but not of intracellular Ca2+.
12948842 Expression of functional PAC(1), VPAC(1) and VPAC(2) receptors in human prostate as well as its maintenance after malignant transformation
12732341 receptors were positively coupled to adenylyl cyclase in human lung cancer, but the enzyme activity was impaired as compared to normal lung
12573802 possible role for PACAP in the regulation of expression of genes encoding catecholamine-synthesizing enzymes in intra-adrenal pheochromocytomas
12409233 Using GST pull-down assay, ARF6 binds to the hop1 but not the null domain of PAC1 receptor
12409223 HCT8 human colon tumor cells express PAC1, and PAC1 activation is coupled to adenylate cyclase, increase cytosolic [Ca(2+)](i), and cellular proliferation
11930171 PACAP receptor type 1 mRNA is expressed in the trigeminal, otic and superior cervical ganglia (prejunctional) and cerebral arteries (postjunctional).

AA Sequence

MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVG      1 - 70
EMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE     71 - 140
SETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWIL    141 - 210
YAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVC    211 - 280
VTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLR    281 - 350
LARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKV    351 - 420
NRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT                          421 - 468
//

Text Mined References (75)

PMID Year Title
26343289 2015 Placental epigenetic patterning of glucocorticoid response genes is associated with infant neurodevelopment.
26334183 2015 Gene-by-social-environment interaction (GxSE) between ADCYAP1R1 genotype and neighborhood crime predicts major depression symptoms in trauma-exposed women.
25918834 2015 Stress and Bronchodilator Response in Children with Asthma.
25680674 2015 Neural Mechanism of a Sex-Specific Risk Variant for Posttraumatic Stress Disorder in the Type I Receptor of the Pituitary Adenylate Cyclase Activating Polypeptide.
25147783 2014 Genetic Associations with Plasma B12, B6, and Folate Levels in an Ischemic Stroke Population from the Vitamin Intervention for Stroke Prevention (VISP) Trial.
24696141 2014 PACAP-induced ERK activation in HEK cells expressing PAC1 receptors involves both receptor internalization and PKC signaling.
24516127 2014 PACAP receptor gene polymorphism impacts fear responses in the amygdala and hippocampus.
24220567 2013 PACAP and PAC1 receptor in brain development and behavior.
23981011 2013 Analysis of PAC1 receptor gene variants in Caucasian and African American infants dying of sudden infant death syndrome.
23972788 2013 Genetic polymorphisms in the PACAP and PAC1 receptor genes and treatment response to venlafaxine XR in generalized anxiety disorder.
23818986 2013 Macrophage Resistance to HIV-1 Infection Is Enhanced by the Neuropeptides VIP and PACAP.
23505260 2013 ADCYAP1R1 genotype associates with post-traumatic stress symptoms in highly traumatized African-American females.
23394710 2013 PAC1 receptor (ADCYAP1R1) genotype is associated with PTSD's emotional numbing symptoms in Chinese earthquake survivors.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23328528 2013 ADCYAP1R1 and asthma in Puerto Rican children.
23280952 2013 Adcyap1r1 genotype, posttraumatic stress disorder, and depression among women exposed to childhood maltreatment.
23147486 2013 PACAP and the PAC1 receptor in post-traumatic stress disorder.
22961270 2012 Nitric oxide and receptors for VIP and PACAP in cutaneous active vasodilation during heat stress in humans.
22776899 2013 PAC1 receptor (ADCYAP1R1) genotype is associated with dark-enhanced startle in children.
22609358 2012 Regulatory mechanism of PAC1 gene expression via Sp1 by nerve growth factor in PC12 cells.
22581436 2012 PYK-2 is tyrosine phosphorylated after activation of pituitary adenylate cyclase activating polypeptide receptors in lung cancer cells.
22539193 2012 Changes in PACAP immunoreactivity in human milk and presence of PAC1 receptor in mammary gland during lactation.
21912390 2012 No association between ADCYAP1R1 and post-traumatic stress disorder in two independent samples.
21625560 2011 Crystal structure of the PAC1R extracellular domain unifies a consensus fold for hormone recognition by class B G-protein coupled receptors.
21621269 2011 Genome-wide association analysis of gender differences in major depressive disorder in the Netherlands NESDA and NTR population-based samples.
21350482 2011 Post-traumatic stress disorder is associated with PACAP and the PAC1 receptor.
21185349 2011 Identification by photoaffinity labeling of the extracellular N-terminal domain of PAC1 receptor as the major binding site for PACAP.
20395540 2010 VIP/PACAP receptor mediation of cutaneous active vasodilation during heat stress in humans.
20026142 2010 Vasoactive intestinal peptide (VIP) receptor expression in monocyte-derived macrophages from COPD patients.
19926922 2010 Luteinizing hormone-stimulated pituitary adenylate cyclase-activating polypeptide system and its role in progesterone production in human luteinized granulosa cells.
19269029 2009 Calmodulin interacts with PAC1 and VPAC2 receptors and regulates PACAP-induced FOS expression in human neuroblastoma cells.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18353507 2008 Novel stable PACAP analogs with potent activity towards the PAC1 receptor.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17470806 2007 Solution structure and mutational analysis of pituitary adenylate cyclase-activating polypeptide binding to the extracellular domain of PAC1-RS.
16939974 2006 Neurotrophin-regulated signalling pathways.
16888199 2006 Neuroendocrine tumors express PAC1 receptors.
16823490 2006 Expression of the human PAC1 receptor leads to dose-dependent hydrocephalus-related abnormalities in mice.
16805430 2006 Promoting neurotrophic effects by GPCR ligands.
16572459 2006 Localization and characterization of pituitary adenylate cyclase-activating polypeptide receptors in the human cerebellum during development.
16401644 2006 The neuropeptide PACAP promotes the alpha-secretase pathway for processing the Alzheimer amyloid precursor protein.
16372333 2006 PAC1-R null isoform expression in human prostate cancer tissue.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16226889 2006 Characterization of novel splice variants of the PAC1 receptor in human neuroblastoma cells: consequences for signaling by VIP and PACAP.
15670850 2005 Calmodulin interacts with the cytoplasmic tails of the parathyroid hormone 1 receptor and a sub-set of class b G-protein coupled receptors.
15518890 2004 Expression of mRNAs for PACAP and its receptor in human neuroblastomas and their relationship to catecholamine synthesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14742913 2004 Differential coupling of the PAC1 SV1 splice variant on human colonic tumors to the activation of intracellular cAMP but not intracellular Ca2+ does not activate tumor proliferation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12948842 2003 Expression of functional PACAP/VIP receptors in human prostate cancer and healthy tissue.
12853948 2003 The DNA sequence of human chromosome 7.
12732341 2003 VIP and PACAP receptors coupled to adenylyl cyclase in human lung cancer: a study in biopsy specimens.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12573802 2003 Expression of mRNA for PACAP and its receptors in intra- and extra-adrenal human pheochromocytomas and their relationship to catecholamine synthesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12409233 2002 Specific interaction between the hop1 intracellular loop 3 domain of the human PAC(1) receptor and ARF.
12409223 2002 PAC1 and PACAP expression, signaling, and effect on the growth of HCT8, human colonic tumor cells.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11959368 2002 Expression of pituitary adenylate cyclase-activating polypeptide and PACAP type 1 receptor in the rat gastric and colonic myenteric neurons.
11930171 2002 Distribution of mRNA for VIP and PACAP receptors in human cerebral arteries and cranial ganglia.
10764955 2000 Immunohistochemical localization and distribution of VIP/PACAP receptors in human lung.
10698193 2000 Pituitary adenylate cyclase-activating polypeptide (PACAP) and PACAP-receptor type 1 expression in rat and human placenta.
10583729 1999 N-terminal splice variants of the type I PACAP receptor: isolation, characterization and ligand binding/selectivity determinants.
10562300 1999 PACAP type I receptor activation regulates ECL cells and gastric acid secretion.
10235634 1999 Identification of pituitary adenylate cyclase activating polypeptide (PACAP) and PACAP type 1 receptor in human skin: expression of PACAP-38 is increased in patients with psoriasis.
9543159 1998 Localization, characterization, and second messenger coupling of pituitary adenylate cyclase-activating polypeptide receptors in the fetal human adrenal gland during the second trimester of gestation.
8954788 1996 Localization of the human pituitary adenylate cyclase-activating polypeptide receptor (PACAP1-R) gene to 7p15-p14 by fluorescence in situ hybridization.
8933357 1996 Tissue specific expression of different human receptor types for pituitary adenylate cyclase activating polypeptide and vasoactive intestinal polypeptide: implications for their role in human physiology.
8770902 1996 Characterization of vasoactive intestinal peptide/pituitary adenylate cyclase-activating peptide receptors in human benign hyperplastic prostate.
8703026 1996 Alternative splicing in the N-terminal extracellular domain of the pituitary adenylate cyclase-activating polypeptide (PACAP) receptor modulates receptor selectivity and relative potencies of PACAP-27 and PACAP-38 in phospholipase C activation.
8663363 1996 Cloning and characterization of the signal transduction of four splice variants of the human pituitary adenylate cyclase activating polypeptide receptor. Evidence for dual coupling to adenylate cyclase and phospholipase C.
8253796 1993 Purification and characterization of the receptor for pituitary adenylate cyclase-activating polypeptide.
7902709 1993 Molecular cloning and functional expression of a cDNA encoding a human pituitary adenylate cyclase activating polypeptide receptor.
7851900 1994 Human type I pituitary adenylate cyclase activating polypeptide receptor (ADCYAP1R): localization to chromosome band 7p14 and integration into the cytogenetic, physical, and genetic map of chromosome 7.