Property Summary

Ligand Count 6
NCBI Gene PubMed Count 75
PubMed Score 94.82
PubTator Score 168.00

Knowledge Summary

Patent (19,732)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.900 5.9e-03
atypical teratoid / rhabdoid tumor -2.700 2.9e-05
ductal carcinoma in situ -1.400 9.7e-05
ependymoma 1.500 2.4e-02
group 3 medulloblastoma -1.300 4.1e-05
intraductal papillary-mucinous adenoma (... -1.200 1.9e-03
invasive ductal carcinoma -1.352 9.6e-04
medulloblastoma, large-cell -2.200 8.1e-06
oligodendroglioma 1.700 4.8e-03
ovarian cancer 1.800 6.6e-05
psoriasis -1.400 1.1e-53
subependymal giant cell astrocytoma -1.583 2.8e-02

Protein-protein Interaction (1)

Gene RIF (47)

AA Sequence

MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVG      1 - 70
EMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE     71 - 140
SETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWIL    141 - 210
YAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVC    211 - 280
VTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLR    281 - 350
LARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKV    351 - 420
NRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT                          421 - 468
//

Text Mined References (78)

PMID Year Title