Property Summary

NCBI Gene PubMed Count 36
PubMed Score 74.40
PubTator Score 37.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.400 1.0e-04
astrocytic glioma -1.100 2.3e-02
atypical teratoid / rhabdoid tumor -1.500 1.1e-04
breast carcinoma 1.100 2.1e-03
dermatomyositis 1.200 1.3e-02
ependymoma -1.300 3.2e-02
glioblastoma -1.400 6.8e-04
intraductal papillary-mucinous adenoma (... -1.200 4.6e-04
intraductal papillary-mucinous carcinoma... -1.100 5.0e-03
lung adenocarcinoma -1.100 2.0e-14
lung cancer -2.000 2.1e-03
medulloblastoma -1.400 1.0e-03
medulloblastoma, large-cell -1.700 4.9e-06
non-small cell lung cancer -1.245 8.7e-15
ovarian cancer -2.200 9.6e-08
primitive neuroectodermal tumor -1.300 6.0e-05
spina bifida -2.235 3.3e-02

Gene RIF (20)

AA Sequence

MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDSGGVPRRVGGG      1 - 70
GRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYALFYIGFACLLWSIYFAVHMRS     71 - 140
RLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALTLLVFALTLAAQFQVLTPVSGRGDSSNLTAT    141 - 210
ARPTDTCLSQVGSFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWE    211 - 280
LLSRGLLHGCIHAIGVHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQG    281 - 350
DEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN    351 - 420
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGV    421 - 490
HTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGKVIERLGQSVVA    491 - 560
DQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVSSGPRGQGTASSGNVSDLAQTVKTFDNLKTC    561 - 630
PSCGITFAPKSEAGAEGGAPQNGCQDEHKNSTKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKG    631 - 700
RWAGVSLDQSALLPLRFKNIREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEE    701 - 770
VIKNSPVKTFASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIR    771 - 840
MVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSEYETNIHFPVFTGSAALIAVVHYC    841 - 910
NFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSVLTSPLDAVQNFSSERNPCNSSVPRDLRRPASLIGQ    911 - 980
EVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLKVSQTY    981 - 1050
SKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGL   1051 - 1120
NTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDT   1121 - 1190
VNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHRVIPQHQLSISP   1191 - 1260
DIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSDSSTQAKDAHLSPKRPWKEPVKAEERGRFGKAIEK   1261 - 1330
DDCDETGIEEANELTKLNVSKSV                                                  1331 - 1353
//

Text Mined References (41)

PMID Year Title