Property Summary

NCBI Gene PubMed Count 35
PubMed Score 21.43
PubTator Score 130.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.700 4.2e-04
astrocytic glioma -2.200 4.1e-03
Astrocytoma, Pilocytic -1.700 6.7e-07
atypical teratoid / rhabdoid tumor -3.600 2.7e-11
chronic rhinosinusitis -1.150 3.4e-03
cutaneous lupus erythematosus -2.200 6.9e-03
ependymoma 1.400 1.1e-02
facioscapulohumeral dystrophy 1.700 1.4e-02
glioblastoma -1.900 5.7e-05
group 3 medulloblastoma -2.600 3.4e-05
interstitial cystitis -1.100 8.7e-03
intraductal papillary-mucinous carcinoma... -1.600 4.4e-04
lung carcinoma 3.500 6.9e-36
medulloblastoma, large-cell -3.100 2.4e-04
oligodendroglioma -2.100 1.1e-02
ovarian cancer -1.200 1.5e-06
primitive neuroectodermal tumor -2.100 5.4e-05
psoriasis -1.400 2.1e-08

Protein-protein Interaction (8)

Gene RIF (16)

AA Sequence

MWQEAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLALLAVFFALGL      1 - 70
EVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAMGYLFMCFGGTVSPWDQVSFF     71 - 140
LFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSATPGGKEHLVWQILANVIIFICGNLAGAYHKH    141 - 210
LMELALQQTYQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHN    211 - 280
LYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPIS    281 - 350
LPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG    351 - 420
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAKMRA    421 - 490
SVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQA    491 - 560
IDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAFKYYVTCACLIFFCIFIVQILVLPKTSVLGI    561 - 630
SFGAAFLLLAFILFVCFAGQLLQCSKKASPLLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFF    631 - 700
LSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVAL    701 - 770
VGYNTILLHTHAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK    771 - 840
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGL    841 - 910
ECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHSQEPERQYMHIGTMVEFAFAL    911 - 980
VGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVL    981 - 1050
QTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS                                1051 - 1091
//

Text Mined References (38)

PMID Year Title