Property Summary

NCBI Gene PubMed Count 8
PubMed Score 23.94
PubTator Score 12.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 4.6e-07
Disease Target Count Z-score Confidence
Thyroid cancer 36 3.244 1.6
Papillary carcinoma 6 3.133 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.045 4.6e-07

Synonym

Accession Q7Z6V5 A6NL12 B3KWY3 Q7Z327 Q8IY39
Symbols TAD2
DEADC1
dJ20N2
dJ20N2.1

Gene

PDB

3DH1  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATR      1 - 70
HAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNI     71 - 140
ASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS                       141 - 191
//

Text Mined References (12)

PMID Year Title