Property Summary

NCBI Gene PubMed Count 23
PubMed Score 44.46
PubTator Score 78.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Substance-Related Disorders 112 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Crohn's disease 311 0.0 0.8
Pulmonary emphysema 44 0.0 0.9
Disease Target Count Z-score Confidence
Sideroblastic anemia 20 3.481 1.7

Expression

  Differential Expression (4)

Gene RIF (9)

AA Sequence

MASVLGSGRGSGGLSSQLKCKSKRRRRRRSKRKDKVSILSTFLAPFKHLSPGITNTEDDDTLSTSSAEVK      1 - 70
ENRNVGNLAARPPPSGDRARGGAPGAKRKRPLEEGNGGHLCKLQLVWKKLSWSVAPKNALVQLHELRPGL     71 - 140
QYRTVSQTGPVHAPVFAVAVEVNGLTFEGTGPTKKKAKMRAAELALRSFVQFPNACQAHLAMGGGPGPGT    141 - 210
DFTSDQADFPDTLFQEFEPPAPRPGLAGGRPGDAALLSAAYGRRRLLCRALDLVGPTPATPAAPGERNPV    211 - 280
VLLNRLRAGLRYVCLAEPAERRARSFVMAVSVDGRTFEGSGRSKKLARGQAAQAALQELFDIQMPGHAPG    281 - 350
RARRTPMPQEFADSISQLVTQKFREVTTDLTPMHARHKALAGIVMTKGLDARQAQVVALSSGTKCISGEH    351 - 420
LSDQGLVVNDCHAEVVARRAFLHFLYTQLELHLSKRREDSERSIFVRLKEGGYRLRENILFHLYVSTSPC    421 - 490
GDARLHSPYEITTDLHSSKHLVRKFRGHLRTKIESGEGTVPVRGPSAVQTWDGVLLGEQLITMSCTDKIA    491 - 560
RWNVLGLQGALLSHFVEPVYLQSIVVGSLHHTGHLARVMSHRMEGVGQLPASYRHNRPLLSGVSDAEARQ    561 - 630
PGKSPPFSMNWVVGSADLEIINATTGRRSCGGPSRLCKHVLSARWARLYGRLSTRTPSPGDTPSMYCEAK    631 - 700
LGAHTYQSVKQQLFKAFQKAGLGTWVRKPPEQQQFLLTL                                   701 - 739
//

Text Mined References (27)

PMID Year Title