Property Summary

NCBI Gene PubMed Count 180
PubMed Score 714.76
PubTator Score 458.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.316 4.6e-03
cutaneous lupus erythematosus 1.200 1.2e-04
astrocytoma 1.300 2.7e-03
Duchenne muscular dystrophy 1.043 6.1e-07
juvenile dermatomyositis 2.511 3.0e-21
intraductal papillary-mucinous neoplasm ... 1.200 2.3e-03
breast carcinoma 1.100 5.5e-04
ovarian cancer 1.800 1.3e-05
dermatomyositis 2.200 3.5e-04

Gene RIF (145)

PMID Text
27060309 The frame-shift mutation c.2638delG and the nonsense mutation c.2867C>A in the ADAR1 gene are associated with the dyschromatosis symmetrica hereditaria.
26892242 A three-generation family exhibiting phenotypic variability with a single germline ADAR1 mutation suggests that chilblain might aggravate the clinical phenotypes of dyschromatosis symmetrica hereditaria.
26817845 ADAR1 p150 as the major A-to-I editor in mouse embryo fibroblasts.
26658668 Recent research has demonstrated that inosine in the epitranscriptome and ADAR1 protein establish innate immune tolerance for host dsRNA formed by endogenous sequences.
26655226 A-to-I RNA editing levels catalyzed by ADAR1 and ADARB1 decreased in Alzheimer's disease patients' brain tissues, mainly in the hippocampus and to a lesser degree in the temporal and frontal lobes.
26485095 These findings suggest that adenosine deaminase acting on RNA 1 is subject to different regulations by DNA methyltransferase and histone deacetylase enzymes in neuronal SH-SY5Y cells.
26363218 our data originally support the evidence that ADAR1 can be part of the cell protein array uploaded in HIV-1 particles.
26363218 p55 Gag associates with ADAR1
26338962 ADAR1, in an editing-independent manner, regulates the biogenesis of miR-222 at the transcription level and thereby ICAM1 expression, which consequently affects melanoma immune resistance.
26335850 transcriptional activation of Adar1 by IFN occurs in the absence of STAT1 by a non-canonical STAT2-dependent pathway in mouse but not human cells.
26084202 The function of primary RNA editing enzyme ADAR1 in pluripotent stem cells was investigated and found that loss of ADAR1 in human iPS cells promotes caspase3-mediated cell death.
26047657 Data show that the protein levels of polypyrimidine tract binding protein 1 (PTBP1) and adenosine deaminase RNA-specific binding protein ADAR1 were cooperatively expressed in glioma tissues and cells.
26037352 The frameshift mutation of ADAR1 gene (c.2252insG) is associated with dyschromatosis symmetrica hereditaria.
25982145 In conclusion, we have found ten novel mutations in the ADAR1 of 7 dyschromatosis symmetrica hereditaria pedigrees and 3 sporadic individuals.
25972541 Measles virus defective interfering RNAs are generated in the absence of C protein and can be destabilized by host ADAR1.
25751603 Genomic analysis of ADAR1 binding reveals its involvement in multiple RNA processing pathways.
25708366 These findings reveal that ADAR1, but not its editing activity, is critical for hESC differentiation and neural induction by regulating miRNA biogenesis via direct RNA interaction.
25692240 Data show that a large fraction of the edited genes are positively correlated ADAR (ADAR1) and ADARB1 (ADAR2).
25673044 Therefore, the expression of ADAR1 and ADAR2 was analyzed in chordoma tissues. It was found that ADAR1 was significantly overexpressed, which was accompanied by enhanced pre-miR-10a and pri-miR-125a A-to-I editing
25468572 To the best of our knowledge, this is the first report of an ADAR mutation in a Korean family with dyschromatosis symmetrica hereditaria.
25456137 ADAR1 mutations causing Aicardi-Goutieres syndrome affect the activity of the interferon-inducible cytoplasmic isoform more severely than the nuclear isoform.
25389016 This study demonstrates that two interferon stimulated genes, i.e. PKR and ADAR1 have opposite effects on HTLV replication in vivo.
25344900 Use molecular dynamics simulation to examine binding mechanism between ADAR1 and Z-DNA.
25272020 shRNA knockdown of ADAR increases HIV-1 RNA copies in OM10.1 cells (latently infected with HIV-1); HIV is restricted by ADAR
25172485 Adenosine deaminase acting on RNA 1 limits RIG-I RNA detection and suppresses IFN production responding to viral and endogenous RNAs.
25010446 NMR experiments on complexes of various ZalphaADAR1 mutants with a 6-bp DNA duplex
24950769 Results identified novel and recurrent mutations of the ADAR1 gene in Chinese families with Dyschromatosis symmetrica hereditaria and demonstrated the importance of exonic nucleotides at exon-intron junctions for RNA splicing.
24928581 among three RNA editing enzymes, only ADAR1 was overexpressed in primary esophageal squamous cell carcinoma compared with matched non-tumor specimens
24813121 The binding of Z-DNA binding domain of human ADAR1 to the G-quadruplex in c-Myc promoter resulted in repression of c-Myc expression.
24753571 ADAR1 carries a unique nuclear localization signal (NLS) that overlaps one of its double-stranded RNA-binding domains (dsRBDs). This dsRBD-NLS is recognized by nuclear import receptor transportin 1 (also called karyopherin-beta2) in an RNA-sensitive manner.
24446047 Two novel DSRAD mutations, p.G1047D and p.Y587C, were found in Chinese patients with DSH and our data add new variants to the knowledge of DSRAD mutations in DSH.
24440912 Findings uncover a critical link of ADAR1 to myogenesis, and further highlight an epigenetic mechanism by which ADAR1 and miR-1/206 interplay to control scheduled myoblast-myotube transition.
24433377 we found a novel nonsense mutation, which will further expand the spectrum of ADAR1 mutations involved in dyschromatosis symmetrica hereditaria.
24351124 A functional polymorphism in ADAR1 gene affects HBsAg seroclearance both spontaneously and interferon induced.
24302582 Our findings reveal that altered gene-specific A-to-I editing events mediated by ADAR1 drive the development of ESCC, with potential implications in diagnosis, prognosis, and treatment of this disease.
24262145 ADAR1-related bilateral striatal necrosis/dystonia is associated with the presence of an interferon signature.
24256817 We then review the more recent findings about the impact of ADAR-mediated activity on the miRNA pathway in terms of biogenesis, target recognition, and gene expression regulation.
24192045 Taken together, our results imply a role for ADAR1 in the regulation of pluripotency induction as well as in the maintenance of early iPSC properties.
24183664 These findings extend the role of ADAR and show that it cooperates with other RNA-processing proteins to regulate the sequence and expression of transcripts in human cells.
24067935 ADAR1 regulates the expression of ARHGAP26 through A-to-I RNA editing by disrupting the binding of miR-30b-3p and miR-573 within the 3' UTR of ARHGAP26.
24065641 This finding improves our understanding of the role of ADAR1 in Dyschromatosis symmetrica hereditaria
23853584 Data suggest that ADAR1 is a pro-viral host factor favoring replication of influenza A virus and dengue virus; viral proteins (influenza A virus NS1 and NS2; dengue virus NS3) appear to control ADAR1 activity.
23766440 Findings highlight the fact that the differentially expressed ADARs in tumours, which are responsible for an A to I RNA editing imbalance, have great prognostic value and diagnostic potential for hepatocellular carcinoma.
23728176 Cancer cells silence ADAR1 by overexpressing miR-17 and miR-432, which both directly target the ADAR1 transcript.
23621649 The deaminase domain is important for ADAR1 function.
23474544 Our global analysis reveals that ADAR plays a major role in splicing regulation.
23336285 We reported four novel mutations in the ADAR1 genes of dyschromatosis symmetrica hereditaria patients.
23315877 Novel dominant ADAR1 mutation was identified in Chinese family with dyschromatosis symmetrica hereditaria.
23275297 functional serial transplantation and shRNA studies demonstrate that ADAR1 knockdown impaired in vivo self-renewal capacity of blast crisis CML progenitors
23166591 p55 Gag associates with ADAR1
23125841 p55 Gag associates with ADAR1
23115276 Measles virus-induced stress granule formation was PKR dependent but impaired by ADAR1.
23079620 This study reveals that Zalpha(ADAR1) initially binds to d(CGCGCG)(2) through the distinct conformation, especially in the unusually flexible beta1-loop-alpha2 region, from the d(CGCGCG)(2)-(Zalpha(ADAR1))(2) complex.
23075647 we have found 2 novel and 1 recurrent mutation, which will expand the database of ADAR1 gene mutations in dyschromatosis symmetrica hereditaria (DSH) and may provide new insight into the pathogenesis of DSH.
23001123 we show that mutations in ADAR1 (also known as ADAR) cause the autoimmune disorder Aicardi-Goutieres syndrome (AGS).
22993189 ADAR-1 massively edits HTLV-2 and STLV-3 retroviruses in vitro, but probably remains a rare phenomenon in vivo.
22974014 More than 100 mutations of ADAR1 have been reported in patients with dyschromatosis symmetrica hereditaria [review].
22885375 Investigatation of structure/activity relationships between ADAR1 and ADAR2 indicates that ADAR1 is more dependent than ADAR2 on the presence of N7 in the edited base.
22843049 A novel DSRAD mutation in several members of a Chinese family expands the gene mutations associated with dyschromatosis symmetrica hereditaria.
22821605 study reports a novel splice site mutation in the ADAR1 gene that is associated with dyschromatosis symmetrica hereditaria, long hair of the forearms, hypo/hyperpigmented hair, and dental anomalies in the affected individuals - a father and his two children
22336994 Eleven novel mutations of the ADAR1 gene have been found in dyschromatosis symmetrica hereditaria.
22278222 ADAR1 suppresses the induction of interferon beta triggered by measles virus infection.
22174317 p55 Gag associates with ADAR1
22104209 p55 Gag associates with ADAR1
22077581 identified three novel heterozygous mutations in the ADAR1 gene in dyschromatosis symmetrica hereditaria
22039911 The novel c.1615delG (p.V539fs) mutation was found in the affected members but not in the healthy individuals in family 1 and the novel c.ins1372-9 CCACAGAT (p.D458fs) mutation was found in patients but not in the healthy members of family 2.
22022963 ADAR1 and not ADAR2 is required for cell survival. [review]
21933234 Two aberrant splice products were confirmed with RT-PCR and DNA direct sequence analysis; these novel findings further extend our understanding of the role of ADAR1 in dyschromatosis symmetrica.
21924887 ADAR1 acts as a suppressor of PKR and displays proviral properties. (Review)
21587236 The editing sites of ADAR1 or ADAR2 in dsRNA are dictated by the catalytic domain.
21490091 ADAR1 enhances replication of RNA viruses through two mechanisms: RNA editing and inhibition of RNA-activated protein kinase (PKR).
21316340 These results demonstrated that ADAR1 isoforms showed different expression patterns, suggesting that they might play different roles in pediatric leukemias.
21301145 A joint study by NECS, SICS, JCS amd AJCS indicated relationship between ADAR and longevity.[review]
21269755 investigation of plasma activity of total ADA, ADA1, and ADA2 in menses, follicular, and luteal phases of menstrual cycle: significant correlation between monocyte number and ADA activities
21217697 the Z-DNA- and Z-RNA-binding domain Zalpha, derived from the human RNA editing enzyme ADAR1-L, binds with high stability to specific rRNA segments of Escherichia coli and human ribosomes.
21159878 ADAR-1 hyperdeaminate adenosine residues in both measles virus and influenza virus A genomes.
21083709 Two novel splice site mutations of the ADAR1 gene in Chinese families with dyschromatosis symmetrica hereditaria
20931541 A missense mutation in the ADAR1 gene was associated with the pathogenesis of the dyschromatosis symmetrical hereditaria.
20875819 Studies indicate that ADAR1 (ZalphaADAR1) preferentially binds Z-DNA rather than B-DNA with high binding affinity.
20844743 Observational study of gene-disease association. (HuGE Navigator)
20805743 Type 1 diabetes subjects show a highly significant increase of ACP1*A/ADA1*2 gametic type compared with healthy subjects from the same population (P = 0.003).
20802353 These data indicate that ADAR1 could play a role in the pathophysiology of suicide in patients with major depression.
20708476 in a Chinese family with dyschromatosis symmetrica hereditaria, a frameshift mutation 767delA (p.H256fs-260X) in exon 2 was found in all affected members but not in the healthy individuals or the 60 unrelated controls
20588308 Observational study of gene-disease association. (HuGE Navigator)
20586835 In conclusion, we have reported an insertion-deletion mutation of ADAR1 involved in dyschromatosis symmetrica hereditaria.
20439151 5 novel mutations found in ADA1 gene in dyschromatosis symmetrical hereditaria in Japan
20430589 four novel and two recurrent mutations of the ADAR1 gene in Chinese patients with dyschromatosis symmetrica hereditaria
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20300939 muation are associated with dyschromatosis symmetrica hereditaria
20186421 mutations are associated with dyschromatosis symmetrica hereditaria
20069304 Report novel missense mutations in DSRAD in Chinese families with dyschromatosis symmetrica hereditaria.
19913273 genetic knockdown results in increased activation of protein kinase PKR and reduced vesicular stomatitis virus growth following IFN treatment
19733181 Results indicate that the ADAR1 deaminase increases exogenous gene expression at the translational level by decreasing PKR-dependent eIF-2alpha phosphorylation.
19713932 Results imply that ADAR1 and ADAR2 have biological functions as RNA-binding proteins that extend beyond editing per se and that even genomically encoded ADARs that are catalytically inactive may have such functions.
19710021 the antiapoptotic activity of ADAR1 is achieved through suppression of activation of proapoptotic and double-stranded RNA-dependent activities, as exemplified by PKR and IRF-3.
19667218 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19651874 p55 Gag associates with ADAR1
19637911 The data support an active B-Z transition mechanism in which the Z alpha(ADAR1) protein first binds to B-DNA and then converts it to left-handed Z-DNA, a conformation that is then stabilized by the additional binding of a second Z alpha(ADAR1) molecule.
19605474 two interferon-induced proteins, ADAR1 and PKR, have antagonistic functions on HIV production
19559055 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19434718 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19124606 dsRBD3 in ADAR1 can mediate nuclear import, while interaction of all dsRBDs might control nuclear export.
18835380 Overexpressed ADAR1 specifically edits a yet unknown cellular substrate, which in turn affects plasmid-based gene expression.
18799292 Four novel mutations of the ADAR1 gene have been reported in patients with dyschromatosis symmetrica hereditaria.
18753201 These data suggested the role of ADAR in modulation of HIV-1 replication.
18705826 histological findings in dyschromatosis symmetrica hereditaria mainly induced by the ADAR1 gene mutations.
18627385 The mutation is a novel heterozygous nucleotide T-->C transition at position 3617 in exon 15 of the DSRAD gene, which induces a M1206T change in the putative deaminase domain of DSRAD.
18422172 ADAR1 mRNA is expressed broadly in larynx carcinoma.
18362360 suggests a regulatory pathway by a combination of ADAR1 A-to-I editing enzyme and RNA degradation presumably with the aid of hUpf1
18243666 Six novel mutations of the ADAR1 gene are reported in Chinese patients with dyschromatosis symmetrica hereditaria.
18178553 elevated levels of ADAR1, as found in astrocytomas, do indeed interfere with ADAR2 specific editing activity, and the endogenous ADAR1 can form heterodimers with ADAR2 in astrocytes
17680540 A deletion mutation (c.2447G > A) in the ADAR gene has been detected in this in a pedigree with dyschromatosis symmetrical hereditar, which is probably one of the molecular bases of the pathogenesis of the disease.
17569068 G to A mutation at the position 3,125 in exon 12 of the DSRAD gene induces a R1042H change in the putative deaminase domain of DSRAD. This, among other DSRAD mutations, is characteristic to dyschromatosis symmetrica hereditaria
17478391 Novel deletion mutation of gene in a Chinese family with Dyschromatosis Symmetrica Hereditaria
17225010 5 families and 3 sporadic patients with dyschromatosis symmetrica hereditaria in a Chinese Han population were studied. By direct sequencing, 5 novel ADAR gene mutations and 3 mutations described previously were identified, all were heterozygous.
17079286 ADAR1 interacts with dsRNA-activated protein kinase PKR, inhibits its kinase activity, and suppresses the alpha subunit of eukaryotic initiation factor 2 (eIF-2alpha) phosphorylation, and thus increases host susceptibility to viral infection.
17033168 Missense mutation of the double-stranded RNA-specific adenosine deaminase gene is associated with dyschromatosis symmetrica hereditaria
17021765 reports two novel mutations c.2116 G > A (E706K) and c.2848 C > T (Q950X) in the DSRAD gene identified in two Chinese pedigrees with DSH
17020943 ADAR1-L induces mutations in the viral RNA which leads to a loss of viral protein function and reduced viral infectivity, and contributes to the innate antiviral immune response.
16917490 10 novel mutations responsible for dyschromatosis symmetrica hereditaria: p.Q102fsX123, p.T369fsX374, p.S664fsX677, p.R892L, p.I913R, p.R916Q, p.P990fsX1016, p.C1081S, p.C1169F, and p.K1187X.
16886895 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16475990 induction of ADAR1-L may at least partially cause the antiviral effect of IFN-alpha in natural immune response to HDV as well as in case of therapeutic administration of IFN
16133458 Identification of a deletion mutation in the ADAR gene of a Chinese family with Dyschromatosis symmetrica hereditaria is reported.
16055709 ADAR1 has the potential both to change information content through editing of mRNA and to regulate gene expression through interacting with NF90
15955093 We report 16 novel mutations containing six missense substitutions, two splice site mutations, six frameshift mutations, and two nonsense mutations found in Japanese patients with dyschromatosis symmetrica hereditaria.
15724015 Frame-shift mutations in the DSRAD gene could cause dyschromatosis symmetrica hereditaria in the chinese population.
15659327 R1155W missense mutation is a new mutation in exon 15 of DSRAD, the pathogenic gene of dyschromatosis symmetrica hereditaria
15342791 Atomic force microscopy imaging of the Zalpha domain of ADAR1 complexed with supercoiled plasmid Z-DNA.
15146470 data add new variants to the repertoire of ADAR mutations in Dyschromatosis symmetrica hereditaria
15102079 This is the first report on DSRAD as the causative gene of dyschromatosis symmetrica hereditaria in the Chinese population.
14711814 the intracellular distribution of the various ADAR1 isoforms is determined by NLS-c, NES, NoLS, and a regulatory motif
12954622 ADAR1 variants are differentially regulated during acute inflammation: the localization of these variants and of A-to-I RNA editing in the cytoplasm, nucleus, and nucleolus is intracellularly reorganized in response to inflammatory stimulation
12916015 mutations involved in causing dyschromatosis symmetrica hereditaria have been identified in the gene that encodes double-stranded RNA-specific adenosine deaminase (DSRAD) as the disease gene
12453429 ADAR1 has a role in protein translation independent of RNA editing
12447867 Observational study of gene-environment interaction. (HuGE Navigator)
12429827 Results identify regions in human adenosine deaminase that acts on RNA (ADAR1) that interfere with nuclear localization and mediate cytoplasmic accumulation.
12414985 ADAR1 is primarily responsible for editing HDV RNA at the amber/W site during HDV infection.
12396729 The IFN-inducible RNA-specific adenosine deaminase ADAR1 promoter possesses a KCS-like (KCS-l) element.
12243919 Up-regulation of type I interferon inducible 150kDa ADAR1 is associated with induction of A to G transcript mutations in systemic lupus erythematosus (SLE) T lymphocytes.
11907222 overexpression inhibits HDV RNA replication and compromises virus viabiltiy
11752786 crystallization and diffraction results when complexed with a chimeric oligonucleotide
11278278 p55 Gag associates with ADAR1
10899322 p55 Gag associates with ADAR1
9330696 p55 Gag associates with ADAR1
9103436 p55 Gag associates with ADAR1

AA Sequence

MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPG      1 - 70
LRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQE     71 - 140
QRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVSTQAWNQHSGV    141 - 210
VRPDGHSQGAPNSDPSLEPEDRNSTSVSEDLLEPFIAVSAQAWNQHSGVVRPDSHSQGSPNSDPGLEPED    211 - 280
SNSTSALEDPLEFLDMAEIKEKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTP    281 - 350
PIWHLTDKKRERMQIKRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEPVIKLE    351 - 420
NRQEARPEPARLKPPVHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRAIMEMPSFYSHGLPRC    421 - 490
SPYKKLTECQLKNPISGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQD    491 - 560
AAMKAMTILLEEAKAKDSGKSEESSHYSTEKESEKTAESQTPTPSATSFFSGKSPVTTLLECMHKLGNSC    561 - 630
EFRLLSKEGPAHEPKFQYCVAVGAQTFPSVSAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISE    631 - 700
SLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFP    701 - 770
AVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTF    771 - 840
HDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCH    841 - 910
AEIISRRGFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRA    911 - 980
MESTESRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQG    981 - 1050
ALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGK   1051 - 1120
TKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAAR   1121 - 1190
DYETAKNYFKKGLKDMGYGNWISKPQEEKNFYLCPV                                     1191 - 1226
//

Text Mined References (200)

PMID Year Title
27060309 2016 [Two novel mutations of the ADAR1 gene associated with dyschromatosis symmetrica hereditaria].
26892242 2016 Genetic spectrum of dyschromatosis symmetrica hereditaria in Chinese patients including a novel nonstop mutation in ADAR1 gene.
26817845 2016 Editing of Cellular Self-RNAs by Adenosine Deaminase ADAR1 Suppresses Innate Immune Stress Responses.
26658668 2015 The Epitranscriptome and Innate Immunity.
26655226 2016 Reduced levels of protein recoding by A-to-I RNA editing in Alzheimer's disease.
26485095 2015 Differential regulation of expression of RNA-editing enzymes, ADAR1 and ADAR2, by 5-aza-2'-deoxycytidine and trichostatin A in human neuronal SH-SY5Y cells.
26363218 2015 The ADAR1 editing enzyme is encapsidated into HIV-1 virions.
26338962 2015 A novel immune resistance mechanism of melanoma cells controlled by the ADAR1 enzyme.
26335850 2015 STAT2-dependent induction of RNA adenosine deaminase ADAR1 by type I interferon differs between mouse and human cells in the requirement for STAT1.
26084202 2015 Loss of ADAR1 in human iPS cells promotes caspase3-mediated apoptotic cell death.
26047657 2015 PTBP1 induces ADAR1 p110 isoform expression through IRES-like dependent translation control and influences cell proliferation in gliomas.
26037352 2015 [Detection of ADAR1 gene mutation in a family with dyschromatosis symmetrica hereditaria].
25982145 2015 Mutation analyses of patients with dyschromatosis symmetrica hereditaria: Ten novel mutations of the ADAR1 gene.
25972541 2015 Measles Virus Defective Interfering RNAs Are Generated Frequently and Early in the Absence of C Protein and Can Be Destabilized by Adenosine Deaminase Acting on RNA-1-Like Hypermutations.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25751603 2015 Genomic analysis of ADAR1 binding and its involvement in multiple RNA processing pathways.
25708366 2015 ADAR1 is required for differentiation and neural induction by regulating microRNA processing in a catalytically independent manner.
25692240 2014 Positive correlation between ADAR expression and its targets suggests a complex regulation mediated by RNA editing in the human brain.
25673044 2015 Overexpression of adenosine deaminase acting on RNA 1 in chordoma tissues is associated with chordoma pathogenesis by reducing miR?125a and miR?10a expression.
25468572 A frameshift mutation in the ADAR gene in a Korean family with dyschromatosis symmetrica hereditaria.
25456137 2014 The RNA-editing enzyme ADAR1 controls innate immune responses to RNA.
25389016 2014 ADAR1 enhances HTLV-1 and HTLV-2 replication through inhibition of PKR activity.
25344900 2014 Understanding the recognition mechanisms of Z? domain of human editing enzyme ADAR1 (hZ?(ADAR1)) and various Z-DNAs from molecular dynamics simulation.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
25172485 2014 Adenosine deaminase acting on RNA 1 limits RIG-I RNA detection and suppresses IFN production responding to viral and endogenous RNAs.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25010446 2014 NMR study of the Z-DNA binding mode and B-Z transition activity of the Z? domain of human ADAR1 when perturbed by mutation on the ?3 helix and ?-hairpin.
24950769 2014 Five novel mutations in the ADAR1 gene associated with dyschromatosis symmetrica hereditaria.
24928581 2014 ADAR1: a promising new biomarker for esophageal squamous cell carcinoma?
24813121 2014 Novel interaction of the Z-DNA binding domain of human ADAR1 with the oncogenic c-Myc promoter G-quadruplex.
24753571 2014 A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1.
24446047 Two novel mutations in the DSRAD gene in two Chinese pedigrees with dyschromatosis symmetrica hereditaria.
24440912 2014 ADAR1 deaminase contributes to scheduled skeletal myogenesis progression via stage-specific functions.
24433377 2014 Mutation analysis of the ADAR1 gene in a Chinese Family with dyschromatosis symmetrica hereditaria.
24351124 2014 A functional polymorphism in ADAR1 gene affects HBsAg seroclearance both spontaneously and interferon induced.
24302582 2014 Adenosine-to-inosine RNA editing mediated by ADARs in esophageal squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24262145 2014 A type I interferon signature identifies bilateral striatal necrosis due to mutations in ADAR1.
24256817 2013 ADAR enzyme and miRNA story: a nucleotide that can make the difference.
24192045 2014 ADAR1 is involved in the regulation of reprogramming human fibroblasts to induced pluripotent stem cells.
24183664 2013 ADAR regulates RNA editing, transcript stability, and gene expression.
24136289 2013 Identification and comparative analysis of hepatitis C virus-host cell protein interactions.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24067935 2013 ADAR1 regulates ARHGAP26 gene expression through RNA editing by disrupting miR-30b-3p and miR-573 binding.
24065641 2013 A novel insertion mutation in the ADAR1 gene of a Chinese family with dyschromatosis symmetrica hereditaria.
23853584 2013 The interactomes of influenza virus NS1 and NS2 proteins identify new host factors and provide insights for ADAR1 playing a supportive role in virus replication.
23766440 2014 A disrupted RNA editing balance mediated by ADARs (Adenosine DeAminases that act on RNA) in human hepatocellular carcinoma.
23728176 2013 MicroRNA-mediated loss of ADAR1 in metastatic melanoma promotes tumor growth.
23622242 2013 ADAR1 forms a complex with Dicer to promote microRNA processing and RNA-induced gene silencing.
23621649 2014 Novel ADAR1 mutations including a single amino acid deletion in the deaminase domain underlie dyschromatosis symmetrica hereditaria in Japanese families.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23474544 2013 Global regulation of alternative splicing by adenosine deaminase acting on RNA (ADAR).
23336285 2012 Four novel ADAR1 gene mutations in patients with dyschromatosis symmetrica hereditaria.
23315877 2013 Mutations in the ADAR1 gene in Chinese families with dyschromatosis symmetrica hereditaria.
23275297 2013 ADAR1 promotes malignant progenitor reprogramming in chronic myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115276 2013 Stress granule formation induced by measles virus is protein kinase PKR dependent and impaired by RNA adenosine deaminase ADAR1.
23079620 2012 NMR dynamics study of the Z-DNA binding domain of human ADAR1 bound to various DNA duplexes.
23075647 Two novel mutations of the ADAR1 gene in Chinese patients with dyschromatosis symmetrica hereditaria.
23001123 2012 Mutations in ADAR1 cause Aicardi-Goutières syndrome associated with a type I interferon signature.
22993189 2012 Hyperediting of human T-cell leukemia virus type 2 and simian T-cell leukemia virus type 3 by the dsRNA adenosine deaminase ADAR-1.
22988838 A-to-I editing of protein coding and noncoding RNAs.
22974014 2013 Dyschromatosis symmetrica hereditaria.
22885375 2012 Nucleoside analog studies indicate mechanistic differences between RNA-editing adenosine deaminases.
22843049 2012 A novel mutation of the DSRAD gene in a Chinese family with dyschromatosis symmetrica hereditaria.
22821605 2012 Dyschromatosis symmetrica hereditaria with long hair on the forearms, hypo/hyperpigmented hair, and dental anomalies: report of a novel ADAR1 mutation.
22810585 2012 Viral immune modulators perturb the human molecular network by common and unique strategies.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22336994 2012 Eleven novel mutations of the ADAR1 gene in dyschromatosis symmetrica hereditaria.
22278222 2012 Adenosine deaminase acting on RNA 1 (ADAR1) suppresses the induction of interferon by measles virus.
22113393 2012 Activity regulation of adenosine deaminases acting on RNA (ADARs).
22077581 2012 Novel clinical and molecular findings in Chinese families with dyschromatosis symmetrica hereditaria.
22039911 2012 Two novel frameshift mutations of the DSRAD gene in Chinese pedigrees with dyschromatosis symmetrica hereditaria.
22022963 2011 RNA editing catalyzed by ADAR1 and its function in mammalian cells.
21933234 2011 Identification of two novel splice mutations of the ADAR1 gene in two Chinese families with dyschromatosis symmetrica hereditaria.
21924887 2011 Protein kinase PKR and RNA adenosine deaminase ADAR1: new roles for old players as modulators of the interferon response.
21769729 2012 ADAR proteins: structure and catalytic mechanism.
21587236 2011 Predicting sites of ADAR editing in double-stranded RNA.
21490091 2011 Enhancement of replication of RNA viruses by ADAR1 via RNA editing and inhibition of RNA-activated protein kinase.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21316340 2011 Abnormal expression of ADAR1 isoforms in Chinese pediatric acute leukemias.
21301145 2010 [Perspective of longevity genes].
21289159 2011 ADAR2 editing enzyme is a novel human immunodeficiency virus-1 proviral factor.
21269755 2011 Adenosine deaminase activity during menses, follicular and luteal phases of the menstrual cycle.
21269460 2011 Initial characterization of the human central proteome.
21217697 2011 Alternate rRNA secondary structures as regulators of translation.
21211811 2011 Adenosine deaminases acting on RNA (ADARs) are both antiviral and proviral.
21182352 2011 Adenosine deaminases acting on RNA, RNA editing, and interferon action.
21159878 2011 Double-stranded RNA adenosine deaminase ADAR-1-induced hypermutated genomes among inactivated seasonal influenza and live attenuated measles virus vaccines.
21083709 2010 Two novel splice site mutations of the ADAR1 gene in Chinese families with dyschromatosis symmetrica hereditaria.
20931541 2010 [The c.3463C>T mutation of the ADAR1 gene in patients with dyschromatosis symmetrical hereditaria].
20875819 2010 Sequence discrimination of the Z? domain of human ADAR1 during B-Z transition of DNA duplexes.
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20805743 2010 Is there a role of ACP1-ADA1 genetic complex in immune reaction? Association with T1D and with past malarial morbidity.
20802353 2010 Increased cortical expression of an RNA editing enzyme occurs in major depressive suicide victims.
20708476 2010 Identification of a novel mutation in the DSRAD gene in a Chinese family with dyschromatosis symmetrica hereditaria.
20590675 2010 The RNA editor gene ADAR1 is induced in myoblasts by inflammatory ligands and buffers stress response.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20586835 2011 A novel complex insertion-deletion mutation in ADAR1 gene in a Chinese family with dyschromatosis symmetrica hereditaria.
20439151 2010 Mutation analyses of patients with dyschromatosis symmetrica hereditaria: five novel mutations of the ADAR1 gene.
20430589 2010 Four novel and two recurrent mutations of the ADAR1 gene in Chinese patients with dyschromatosis symmetrica hereditaria.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20300939 2010 Two new mutations of the ADAR1 gene associated with dyschromatosis symmetrica hereditaria.
20192758 2010 Functions and regulation of RNA editing by ADAR deaminases.
20186421 2010 Mutational spectrum of the ADAR1 gene in dyschromatosis symmetrica hereditaria.
20069304 2010 Identification of two novel DSRAD mutations in two Chinese families with dyschromatosis symmetrica hereditaria.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913273 2010 RNA adenosine deaminase ADAR1 deficiency leads to increased activation of protein kinase PKR and reduced vesicular stomatitis virus growth following interferon treatment.
19908260 2010 Human BLCAP transcript: new editing events in normal and cancerous tissues.
19733181 2009 Adenosine deaminase ADAR1 increases gene expression at the translational level by decreasing protein kinase PKR-dependent eIF-2alpha phosphorylation.
19713932 2009 Editing independent effects of ADARs on the miRNA/siRNA pathways.
19710021 2009 RNA-specific adenosine deaminase ADAR1 suppresses measles virus-induced apoptosis and activation of protein kinase PKR.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19667218 2009 Genome-wide scan of 500,000 single-nucleotide polymorphisms among responders and nonresponders to interferon beta therapy in multiple sclerosis.
19651874 2009 Editing of HIV-1 RNA by the double-stranded RNA deaminase ADAR1 stimulates viral infection.
19637911 2009 NMR spectroscopic elucidation of the B-Z transition of a DNA double helix induced by the Z alpha domain of human ADAR1.
19605474 2009 ADAR1 interacts with PKR during human immunodeficiency virus infection of lymphocytes and contributes to viral replication.
19559055 2009 A pharmacogenetic study of polymorphisms in interferon pathway genes and response to interferon-alpha treatment in chronic hepatitis B patients.
19434718 2009 Variants in interferon-alpha pathway genes and response to pegylated interferon-Alpha2a plus ribavirin for treatment of chronic hepatitis C virus infection in the hepatitis C antiviral long-term treatment against cirrhosis trial.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19124606 2009 RNA-regulated interaction of transportin-1 and exportin-5 with the double-stranded RNA-binding domain regulates nucleocytoplasmic shuttling of ADAR1.
18835380 2008 Characterization of ADAR1-mediated modulation of gene expression.
18799292 2009 Four novel mutations of the ADAR1 gene in dyschromatosis symmetrica hereditaria.
18753201 2008 Double-stranded RNA adenosine deaminases enhance expression of human immunodeficiency virus type 1 proteins.
18705826 2008 Six novel mutations of the ADAR1 gene in patients with dyschromatosis symmetrica hereditaria: histological observation and comparison of genotypes and clinical phenotypes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18627385 2008 Identification of a novel DSRAD gene mutation in a Chinese family with dyschromatosis symmetrica hereditaria.
18422172 2008 [Detection of ADAR1 mRNA expression in larynx carcinoma tissues].
18362360 2008 The editing enzyme ADAR1 and the mRNA surveillance protein hUpf1 interact in the cell nucleus.
18243666 2008 Six novel mutations of the ADAR1 gene in Chinese patients with dyschromatosis symmetrica hereditaria.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18178553 2008 Down-regulation of RNA editing in pediatric astrocytomas: ADAR2 editing activity inhibits cell migration and proliferation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17698644 2007 Alternative splicing of the ADAR1 transcript in a region that functions either as a 5'-UTR or an ORF.
17680540 2007 [Analysis on the mutation of ADAR gene in a pedigree with dyschromatosis symmetrical hereditaria].
17569068 2007 A novel missense mutation in DSRAD in a family with dyschromatosis symmetrica hereditaria.
17478391 Novel deletion mutation of DSRAD in a Chinese family with Dyschromatosis Symmetrica Hereditaria (DSH).
17225010 2007 Five novel mutations of RNA-specific adenosine deaminase gene with dyschromatosis symmetrica hereditaria.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17079286 2007 Double-stranded RNA deaminase ADAR1 increases host susceptibility to virus infection.
17033168 2006 A new mutation of the double-stranded RNA-specific adenosine deaminase gene in a family with dyschromatosis symmetrica hereditaria.
17021765 2006 Identification of two novel DSRAD mutations in two Chinese families with dyschromatosis symmetrica hereditaria.
17020943 2007 A-to-G hypermutation in the genome of lymphocytic choriomeningitis virus.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16917490 2007 Ten novel mutations of the ADAR1 gene in Japanese patients with dyschromatosis symmetrica hereditaria.
16886895 2006 Genetic predisposition of responsiveness to therapy for chronic hepatitis C.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16475990 2006 The large form of ADAR 1 is responsible for enhanced hepatitis delta virus RNA editing in interferon-alpha-stimulated host cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16133458 2005 Identification of a novel ADAR mutation in a Chinese family with dyschromatosis symmetrica hereditaria (DSH).
16120648 2005 SUMO-1 modification alters ADAR1 editing activity.
16055709 2005 ADAR1 interacts with NF90 through double-stranded RNA and regulates NF90-mediated gene expression independently of RNA editing.
15955093 2005 Mutation analysis of the ADAR1 gene in dyschromatosis symmetrica hereditaria and genetic differentiation from both dyschromatosis universalis hereditaria and acropigmentatio reticularis.
15858013 2005 New antiviral pathway that mediates hepatitis C virus replicon interferon sensitivity through ADAR1.
15724015 2005 Two frameshift mutations in the RNA-specific adenosine deaminase gene associated with dyschromatosis symmetrica hereditaria.
15723802 2005 Vigilins bind to promiscuously A-to-I-edited RNAs and are involved in the formation of heterochromatin.
15659327 2005 A new arginine substitution mutation of DSRAD gene in a Chinese family with dyschromatosis symmetrica hereditaria.
15635413 2005 Nucleolar proteome dynamics.
15556947 2005 ADAR1 RNA deaminase limits short interfering RNA efficacy in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342791 2004 Interaction of the Zalpha domain of human ADAR1 with a negatively supercoiled plasmid visualized by atomic force microscopy.
15146470 2004 Seven novel mutations of the ADAR gene in Chinese families and sporadic patients with dyschromatosis symmetrica hereditaria (DSH).
15102079 2004 Novel mutations of the RNA-specific adenosine deaminase gene (DSRAD) in Chinese families with dyschromatosis symmetrica hereditaria.
14711814 2004 Subcellular distribution of ADAR1 isoforms is synergistically determined by three nuclear discrimination signals and a regulatory motif.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12954622 2003 Intracellular localization of differentially regulated RNA-specific adenosine deaminase isoforms in inflammation.
12916015 2003 Mutations of the RNA-specific adenosine deaminase gene (DSRAD) are involved in dyschromatosis symmetrica hereditaria.
12702817 2003 Elevated activity of the large form of ADAR1 in vivo: very efficient RNA editing occurs in the cytoplasm.
12665561 2003 Dynamic association of RNA-editing enzymes with the nucleolus.
12618436 2003 Requirement of dimerization for RNA editing activity of adenosine deaminases acting on RNA.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453429 2002 Induction of protein translation by ADAR1 within living cell nuclei is not dependent on RNA editing.
12447867 2002 Genetic polymorphisms in interferon pathway and response to interferon treatment in hepatitis B patients: A pilot study.
12429827 2002 Nucleocytoplasmic distribution of human RNA-editing enzyme ADAR1 is modulated by double-stranded RNA-binding domains, a leucine-rich export signal, and a putative dimerization domain.
12414985 2002 Inhibition of hepatitis delta virus RNA editing by short inhibitory RNA-mediated knockdown of ADAR1 but not ADAR2 expression.
12396729 2002 The promoter-proximal KCS element of the PKR kinase gene enhances transcription irrespective of orientation and position relative to the ISRE element and is functionally distinct from the KCS-like element of the ADAR deaminase Promoter.
12243919 2002 Transcript mutations of the alpha regulatory subunit of protein kinase A and up-regulation of the RNA-editing gene transcript in lupus T lymphocytes.
11907222 2002 Increased RNA editing and inhibition of hepatitis delta virus replication by high-level expression of ADAR1 and ADAR2.
11604520 2001 CRM1 mediates the export of ADAR1 through a nuclear export signal within the Z-DNA binding domain.
11593027 2001 The role of binding domains for dsRNA and Z-DNA in the in vivo editing of minimal substrates by ADAR1.
11451992 2001 The human but not the Xenopus RNA-editing enzyme ADAR1 has an atypical nuclear localization signal and displays the characteristics of a shuttling protein.
11421361 2001 Substrate recognition by ADAR1 and ADAR2.
10535945 1999 The solution structure of the Zalpha domain of the human RNA editing enzyme ADAR1 reveals a prepositioned binding surface for Z-DNA.
10364558 1999 Crystal structure of the Zalpha domain of the human editing enzyme ADAR1 bound to left-handed Z-DNA.
10200312 1999 Human RNA-specific adenosine deaminase ADAR1 transcripts possess alternative exon 1 structures that initiate from different promoters, one constitutively active and the other interferon inducible.
9735305 1998 Double-stranded RNA-specific adenosine deaminase: nucleic acid binding properties.
9237992 1997 A Z-DNA binding domain present in the human editing enzyme, double-stranded RNA adenosine deaminase.
9020165 1997 Functionally distinct double-stranded RNA-binding domains associated with alternative splice site variants of the interferon-inducible double-stranded RNA-specific adenosine deaminase.
8586444 1995 The interferon-inducible, double-stranded RNA-specific adenosine deaminase gene (DSRAD) maps to human chromosome 1q21.1-21.2.
7972084 1994 Molecular cloning of cDNA for double-stranded RNA adenosine deaminase, a candidate enzyme for nuclear RNA editing.
7862132 1995 Cloning of cDNAs encoding mammalian double-stranded RNA-specific adenosine deaminase.
7618288 1995 Mechanism of interferon action: double-stranded RNA-specific adenosine deaminase from human cells is inducible by alpha and gamma interferons.
7565688 1995 Expression and regulation by interferon of a double-stranded-RNA-specific adenosine deaminase from human cells: evidence for two forms of the deaminase.
7490742 1995 Genomic organization and chromosomal location of the human dsRNA adenosine deaminase gene: the enzyme for glutamate-activated ion channel RNA editing.
3175763 1988 Cloning and chromosomal location of human genes inducible by type I interferon.