Property Summary

NCBI Gene PubMed Count 94
PubMed Score 46.65
PubTator Score 149.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 2.7e-80
osteosarcoma 7933 1.6e-06
inflammatory breast cancer 404 4.5e-03
non diabetic and post-ischemic heart failure 200 4.7e-03
Disease Target Count Z-score Confidence
Osteoarthritis 96 5.417 2.7

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.419 1.6e-06
non diabetic and post-ischemic heart fai... -1.200 4.7e-03
inflammatory breast cancer 1.700 4.5e-03
psoriasis 2.100 2.7e-80

Gene RIF (75)

PMID Text
26916548 progesterone acts via the progesterone receptor to modulate ADAMTS 1 and 4 levels in ovarian cancer cell lines.
26612259 These data demonstrate that the antibody is specific to ADAMTS4 and ADAMTS5 and inhibits their aggrecanase activity at molecular and cellular levels.
25709087 CCN1 suppresses ADAMTS-4 activity and that CCN1 overexpression is directly correlated with chondrocyte cloning in osteoarthritis cartilage. The TGFbeta/CCN1 axis plays a role in chondrocyte cluster formation through inhibition of ADAMTS-4.
25707877 A positive feedback loop involving sSema4D/IL-6 and TNFalpha/ADAMTS-4 may contribute to the pathogenesis of rheumatoid arthritis.
25592103 ADAMTS4 may be responsible for the pathogenesis of atherosclerosis. ADAMTS4 serum levels were also higher in diabetic cases. There is an association between ADAMTS4 and TGFb1 serum levels in the progression of atherosclerosis in coronary artery disease.
25501175 ADAMTS-4 is a potential biomarker and an early diagnostic indicator of knee osteoarthritis.
25477257 Evaluate ADAMTS-4 and ADAMTS-5 immunohistochemical expression in human TMJ discs from patients affected by internal derangement.
25225099 ADAMTS4 is largely associated with synapses, and is the main brevican-processing protease.
24786121 The restricted expression of ADAMTS-4 and ADAMTS-5 and their increased expression in gestational trophoblastic diseases suggest that these 2 ADAMTS subtypes are associated with human placentation and the development of gestational trophoblastic diseases.
24732836 We conclude that the upregulation of TNF-alpha and ADAMTS-5, but not ADAMTS-4, may play an important role in degenerative cartilage endplate-induced low back pain.
24474687 This study highlights that the affinity between a ligand and LRP1 dictates the rate of internalization and suggests that LRP1 is a major traffic controller of the two aggrecanases, especially under inflammatory conditions, where the protein levels of ADAMTS-4 increase, but those of ADAMTS-5 do not.
24126638 This is the first evidence of crosstalk between TNF-alpha and ADAMTS-4 in relation to osteoarthritis cartilage degradation.
24051360 ADAMTS-4 and its substrate biglycan are involved in tubulogenesis by endothelial cells
23897278 ADAMTS-4_v1 is expressed as a protein in vivo in human osteoarthritis synovium, functions as an aggrecanase, and cleaves other proteoglycan substrates.
23859810 We have demonstrated that the expression of ADAMTS-1, -4 and -5 is induced during the differentiation of monocytes into macrophages.
23438438 The purpose of the present study was to investigate the precise molecular mechanisms of high molecular weight hyaluronic acid on ADAMTS4 expression induced by IL- 1b in vitro.
23406982 Our results indicate that miR-125b plays an important role in regulating the expression of ADAMTS-4 in human chondrocytes
23319426 AMTS4 has roles in melanoma growth and angiogenesis
23295731 Cartilage affected by varying degrees of osteoarthritis stained strongly for active ADAMTS-4 where surface fibrillation and clustered chondrocytes were observed.
23137648 Citrullinated fibronectin is less effective in inhibiting the proteolytic activity of ADAMTS4 and may contribute to the destruction of joint cartilage in rheumatoid arthritis.
23082219 The serine protease tissue plasminogen activator (tPA) and two matrix metalloproteinases, ADAMTS-4 and ADAMTS-5, were identified as Reelin cleaving enzymes.
22735305 study showed that ADAMTS-1, -4, -5 and TIMP3 were expressed at differential levels in hepatocellular carcinoma cell lines
22670872 Data suggest that cleavage of aggrecan by matrix metalloproteinases in knee cartilage from injured or osteoarthritic subjects is low compared with cleavage by aggrecanase-1 (at least early in osteoarthritis, as suggested by other evidence).
22562232 Data show that the expression of ADAMTS4, 9, 16 and was up-regulated during chondrogenesis, ADAMTS1 and 5 were down-regulated.
22324945 Suggest IL-6 may participate in cartilage destruction in rheumatoid arthritis as an inducer of ADAMTS-4 expression from synoviocytes.
22065068 Sp1 transcription factor partly mediates IL-1 induction of ADAMTS-4.
21946608 Serum ADAMTS4 levels are associated with the presence and the severity of coronary artery disease.
21664283 results suggest that during the acute phase after knee injury there is an increased aggrecanase activity against both the interglobular domain (IGD) and the CS2 cleavage sites of joint cartilage aggrecan
21345877 ADAMTS-4 is present in human coronary atherosclerotic plaques.
21334453 effect of transforming growth factor-beta (TGF-beta) on ADAMTS-4 expression in macrophages along with the regulatory mechanisms underlying its actions
20857147 Multiple matrix metalloproteinases and ADAMTS-4 are involved in the natural history of interverteral lumbar disc herniation.
20664926 ADAMTS4 expression was found to be regulated by EWS-FLI1 fusion gene-dependent manner. ADAMTS4 protein was highly expressed in tumor samples of the patients with EWS by using immunohistochemistry.
20625753 Patients with acute coronary syndrome showed increased ADAMTS4 expression, which may aggravate the development of atherosclerosis and instability of atherosclerotic plaques.
19944557 Plasma ADAMTS4 was measured in stable-effort angina pectoris, acute coronary syndrome & controls. The pattern of its release was clearly different in various forms of ACS. It showed a weak correlation with high-sensitivity C-reactive protein.
19643179 The C-terminal domains of ADAMTS-4 and ADAMTS-5 affect the structure around the active site, favouring interaction with TIMP-3.
19342688 findings suggest that Ras, ROS along with MyD88, IRAK1, or TRAF6 synergistically mediate ADAMTS-4 regulation by IL1-beta
19054571 Observational study of gene-disease association. (HuGE Navigator)
18941754 Expression of ADAMTS4 by chondrocytes in the surface zone of human osteoarthritic cartilage is regulated by epigenetic DNA de-de-methylation.
18671934 PACE4 is a proprotein convertase responsible for activation of aggrecanases in osteoarthritic and cytokine-stimulated cartilage; posttranslational activation of ADAMTS-4 and ADAMTS-5 in the extracellular milieu of cartilage results in aggrecan degradation
18660489 Observational study of gene-disease association. (HuGE Navigator)
18387286 Both ADAMTS-4 mRNA and protein processing may be differentially regulated in normal and damaged tendons.
18221525 Human ADAMTS-4 was expressed in rodent pyramidal neurons and neuropil of stratum oriens and the lacunosum moleculare.
18156631 the catalytic domain of ADAMTS-5 has higher intrinsic catalytic ability than that of ADAMTS-4
18050214 PKCzeta is involved in regulation of IL-1beta-induced NF-kappaB signaling in human osteoarthritis chondrocytes, which regulates downstream expression of ADAMTS-4 and NOS2 via NF-kappaB.
18042673 Crystal structures of the two most active human aggrecanase isoforms, ADAMTS4 and ADAMTS5, each in complex with bound inhiitor.
18039650 after stimulation, the protease activity of PC5A is enhanced, as evidenced by the cleavage of the PC5A substrates Lefty, ADAMTS-4, endothelial lipase, and PCSK9.
17978660 In both nucleus pulposis and anulus fibrosus, ADAMTS4 was higher in discs with a higher level of degeneration. Aggrecan fragmentation profile analysis showed the involvement of aggrecanases and other proteases during disc degeneration.
17606262 ADAMTS-4 and -8 are inflammatory regulated enzymes expressed in macrophage-rich areas of atherosclerotic plaques.
17470431 TIMP-3 inhibition of ADAMTS-4 is modulated by interactions between aggrecan and the C-terminal domain of ADAMTS-4
17430884 ADAMTS-5 is a major aggrecanase in cartilage metabolism and pathology, with aggrecanase activity at least 1,000-fold greater than that of ADAMTS-4 under physiological conditions
17311924 recombinant ADAMTS-4 effectively cleaved intact matrilin-3 at the predicted motif at Glu435/Ala436 generating two species of 45 and 5 kDa
17295438 Inhibition of NF0kappaB results in the decreased expression of several destructive metalloproteinases and also the ADAMTS4 aggrecanase
17265492 Our data suggest that both ADAMTS-4 and ADAMTS-5 contribute to the structural damage that characterizes human osteoarthritis.
17208315 oncostatin M-stimulated ADAMTS-4 and matrix metallopeptidase 13 expression is mediated by extracellular signal-regulated kinases, Janus kinase 3/STAT1/3 and phosphatidylinositol 3-kinase/Akt and by cross talk between these pathways
17095512 analysis of aggrecanase (ADAMTS-4) conformation, affinity and sequence specificity
17009305 The induction of ADAMTS-4 by B burgdorferi results in the cleavage of aggrecan, which may be an important first step that leads to permanent degradation of cartilage.
16771712 The inhibition of ADAMTS-2 by TIMP-3 alone out of 4 TIMP proteins is reported.
16741450 Macrophages infiltrating granulation and adjacent disc tissues express ADAMTS-4, suggesting its involvement in herniated disc regression.
16723216 analysis of osteoarthritic synovium using primers designed to amplify across the exon 8/9 junction resulted in amplification of the expected product and a smaller product missing 161 bp from the 5' end of exon 9, the result of alternative splicing
16677612 The ADAMTS-4 promoter would serve as a valuable mechanistic tool to better understand the regulation of ADAMTS-4 expression by signaling pathways that modulate cartilage matrix breakdown.
16099106 Taken together, these data suggest that aggrecanase-1 and alpha1-antitrypsin bind in vivo, although the physiological significance of the interaction between aggrecanase-1 and alpha1-antitrypsin remains unclear.
16003758 ADAMTS4 and 5 are upregulated on proliferating glioblastoma cells, and these proteases may contribute to their invasive potential
15161923 the aggrecanase activity of ADAMTS4 is inhibited by fibronectin through interaction with their C-terminal domains
14744861 pro-ADAMTS4 is cleaved by proprotein convertase furin in the trans-Golgi network
14715656 ADAMTS4 and ADAMTS5 are inhibited by alpha2-macroglobulin
14701864 ADAMTS-4 activation involves the coordinated activity of both glycosylphosphatidyl inositol-anchored MT4-MMP and the proteoglycan form of syndecan-1 on the cell surface
14662755 ADAMTS-4 lacking the spacer domain has promiscuous substrate specificity considerably different from that previously reported for aggrecan core protein
14561220 Multiple forms of ADAMTS4 protein characterized by Western analysis in human brain tissue lead to the conclusion that the 'aggrecanase' group of the ADAMTS family (ADAMTS 1, 4, 5 and 9) is responsible for turnover of versican V2 in the adult brain.
12646579 ADAMTS-2 metalloproteinase is shown to cleave procollagen III N-propeptides as effectively as those of procollagens I and II
12202483 Autocatalytic cleavage reveals multiple glycosaminoglycan-binding sites
11956193 Inhibition of ADAM-TS4 and ADAM-TS5 prevents aggrecan degradation in osteoarthritic cartilage.
11854269 has a specific cleavage site at the matrix metalloproteinase site in its interglobular domain
11831030 extracellular matrix degrading enzyme
11801682 Aggrecanase-1 is expressed by fibroblast-like synoviocytes from rheumatoid arthritis and osteoarthritis patients and is induced by cytokines, especially TGF-beta.
11796708 activation of proteolytic activity by C-terminal truncation

AA Sequence

MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEEIVFPEKLNGS      1 - 70
VLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVA     71 - 140
SLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCNVKAPLGSPSPRPRRA    141 - 210
KRFASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQ    211 - 280
VGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVED    281 - 350
DGLQSAFTAAHELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY    351 - 420
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWA    421 - 490
DGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGVQFSSRDCTRPVPRNGGKYCE    491 - 560
GRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSFPGPMDWVPRYTGVAPQDQCKLTCQAQALGY    561 - 630
YYVLEPRVVDGTPCSPDSSSVCVQGRCIHAGCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYN    631 - 700
NVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASET    701 - 770
LSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK       771 - 837
//

Text Mined References (94)

PMID Year Title
26916548 2016 Progesterone acts via the progesterone receptor to induce adamts proteases in ovarian cancer cells.
26612259 2016 Development of human neutralizing antibody to ADAMTS4 (aggrecanase-1) and ADAMTS5 (aggrecanase-2).
25709087 2015 CCN1 (Cyr61) Is Overexpressed in Human Osteoarthritic Cartilage and Inhibits ADAMTS-4 (Aggrecanase 1) Activity.
25707877 2015 Semaphorin 4D Contributes to Rheumatoid Arthritis by Inducing Inflammatory Cytokine Production: Pathogenic and Therapeutic Implications.
25606593 2014 Current and emerging therapeutic strategies for preventing inflammation and aggrecanase-mediated cartilage destruction in arthritis.
25592103 2015 A novel association between TGFb1 and ADAMTS4 in coronary artery disease: A new potential mechanism in the progression of atherosclerosis and diabetes.
25501175 2014 Increased serum ADAMTS-4 in knee osteoarthritis: a potential indicator for the diagnosis of osteoarthritis in early stages.
25477257 2015 ADAMTS-4 and ADAMTS-5 expression in human temporomandibular joint discs with internal derangement, correlates with degeneration.
25225099 2014 Hyaluronan-based extracellular matrix under conditions of homeostatic plasticity.
24786121 2014 Differential expression patterns of a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS) -1, -4, -5, and -14 in human placenta and gestational trophoblastic diseases.
24732836 2014 Upregulation of tumor necrosis factor ? and ADAMTS-5, but not ADAMTS-4, in human intervertebral cartilage endplate with modic changes.
24474687 2014 Low density lipoprotein receptor-related protein 1 (LRP1)-mediated endocytic clearance of a disintegrin and metalloproteinase with thrombospondin motifs-4 (ADAMTS-4): functional differences of non-catalytic domains of ADAMTS-4 and ADAMTS-5 in LRP1 binding.
24126638 2013 Tumor necrosis factor-? induces ADAMTS-4 expression in human osteoarthritis chondrocytes.
24051360 2014 ADAMTS-4 and biglycan are expressed at high levels and co-localize to podosomes during endothelial cell tubulogenesis in vitro.
23897278 2013 ADAMTS-4_v1 is a splice variant of ADAMTS-4 that is expressed as a protein in human synovium and cleaves aggrecan at the interglobular domain.
23859810 2013 Regulation of ADAMTS-1, -4 and -5 expression in human macrophages: differential regulation by key cytokines implicated in atherosclerosis and novel synergism between TL1A and IL-17.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23438438 2013 Mechanisms involved in suppression of ADAMTS4 expression in synoviocytes by high molecular weight hyaluronic acid.
23406982 2013 MicroRNA-125b regulates the expression of aggrecanase-1 (ADAMTS-4) in human osteoarthritic chondrocytes.
23319426 2013 ADAMTS4 and its proteolytic fragments differentially affect melanoma growth and angiogenesis in mice.
23295731 2013 The development and characterization of a competitive ELISA for measuring active ADAMTS-4 in a bovine cartilage ex vivo model.
23137648 The low binding affinity of ADAMTS4 for citrullinated fibronectin may contribute to the destruction of joint cartilage in rheumatoid arthritis.
23082219 2012 Regulated proteolytic processing of Reelin through interplay of tissue plasminogen activator (tPA), ADAMTS-4, ADAMTS-5, and their modulators.
22735305 2012 Expression of ADAMTS-1, ADAMTS-4, ADAMTS-5 and TIMP3 by hepatocellular carcinoma cell lines.
22670872 2012 MMP proteolysis of the human extracellular matrix protein aggrecan is mainly a process of normal turnover.
22562232 2012 Regulation of aggrecanases from the ADAMTS family and aggrecan neoepitope formation during in vitro chondrogenesis of human mesenchymal stem cells.
22324945 2012 Interleukin-6 upregulates expression of ADAMTS-4 in fibroblast-like synoviocytes from patients with rheumatoid arthritis.
22065068 2013 Role of Sp1 transcription factor in Interleukin-1-induced ADAMTS-4 (aggrecanase-1) gene expression in human articular chondrocytes.
21946608 2011 Association of serum a disintegrin and metalloproteinase with thrombospodin motif 4 levels with the presence and severity of coronary artery disease.
21664283 2011 Human aggrecanase generated synovial fluid fragment levels are elevated directly after knee injuries due to proteolysis both in the inter globular and chondroitin sulfate domains.
21345877 2011 Comparison of ADAMTS-1, -4 and -5 expression in culprit plaques between acute myocardial infarction and stable angina.
21334453 2011 The expression of a disintegrin and metalloproteinase with thrombospondin motifs 4 in human macrophages is inhibited by the anti-atherogenic cytokine transforming growth factor-? and requires Smads, p38 mitogen-activated protein kinase and c-Jun.
20857147 2011 Transcript levels of major MMPs and ADAMTS-4 in relation to the clinicopathological profile of patients with lumbar disc herniation.
20664926 2010 Expression of ADAMTS4 in Ewing's sarcoma.
20625753 2010 Elevated level of ADAMTS4 in plasma and peripheral monocytes from patients with acute coronary syndrome.
19944557 2010 ADAMTS4 level in patients with stable coronary artery disease and acute coronary syndromes.
19643179 2009 The C-terminal domains of ADAMTS-4 and ADAMTS-5 promote association with N-TIMP-3.
19342688 2009 Adaptor proteins and Ras synergistically regulate IL-1-induced ADAMTS-4 expression in human chondrocytes.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
18941754 2009 Expression of ADAMTS-4 by chondrocytes in the surface zone of human osteoarthritic cartilage is regulated by epigenetic DNA de-methylation.
18718938 2008 Epileptic and developmental disorders of the speech cortex: ligand/receptor interaction of wild-type and mutant SRPX2 with the plasminogen activator receptor uPAR.
18671934 2008 Proprotein convertase activation of aggrecanases in cartilage in situ.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18387286 2008 The regulation of aggrecanase ADAMTS-4 expression in human Achilles tendon and tendon-derived cells.
18221525 2008 Discordant localization of WFA reactivity and brevican/ADAMTS-derived fragment in rodent brain.
18156631 2008 Functional differences of the catalytic and non-catalytic domains in human ADAMTS-4 and ADAMTS-5 in aggrecanolytic activity.
18050214 2007 Involvement of protein kinase Czeta in interleukin-1beta induction of ADAMTS-4 and type 2 nitric oxide synthase via NF-kappaB signaling in primary human osteoarthritic chondrocytes.
18042673 2008 Crystal structures of the two major aggrecan degrading enzymes, ADAMTS4 and ADAMTS5.
18039650 2008 The regulated cell surface zymogen activation of the proprotein convertase PC5A directs the processing of its secretory substrates.
17978660 2007 Aggrecanases and aggrecanase-generated fragments in the human intervertebral disc at early and advanced stages of disc degeneration.
17606262 2008 ADAMTS-4 and -8 are inflammatory regulated enzymes expressed in macrophage-rich areas of human atherosclerotic plaques.
17470431 2007 TIMP-3 inhibition of ADAMTS-4 (Aggrecanase-1) is modulated by interactions between aggrecan and the C-terminal domain of ADAMTS-4.
17430884 2007 Proteolytic activities of human ADAMTS-5: comparative studies with ADAMTS-4.
17311924 2007 Identification of an ADAMTS-4 cleavage motif using phage display leads to the development of fluorogenic peptide substrates and reveals matrilin-3 as a novel substrate.
17295438 2007 Adenoviral gene transfer of the endogenous inhibitor IkappaBalpha into human osteoarthritis synovial fibroblasts demonstrates that several matrix metalloproteinases and aggrecanases are nuclear factor-kappaB-dependent.
17265492 2007 Aggrecan degradation in human articular cartilage explants is mediated by both ADAMTS-4 and ADAMTS-5.
17208315 2007 Signaling pathways implicated in oncostatin M-induced aggrecanase-1 and matrix metalloproteinase-13 expression in human articular chondrocytes.
17095512 2007 Substrate conformation modulates aggrecanase (ADAMTS-4) affinity and sequence specificity. Suggestion of a common topological specificity for functionally diverse proteases.
17009305 2006 Role of aggrecanase 1 in Lyme arthritis.
16771712 2006 TIMP-3 inhibits the procollagen N-proteinase ADAMTS-2.
16741450 2006 Expression of ADAMTS-4 (aggrecanase-1) and possible involvement in regression of lumbar disc herniation.
16723216 2006 An alternative spliced transcript of ADAMTS4 is present in human synovium from OA patients.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16677612 2006 Regulation of the human ADAMTS-4 promoter by transcription factors and cytokines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16099106 2005 Aggrecanase-1 (ADAMTS-4) interacts with alpha1-antitrypsin.
16003758 2006 Matrix-degrading proteases ADAMTS4 and ADAMTS5 (disintegrins and metalloproteinases with thrombospondin motifs 4 and 5) are expressed in human glioblastomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15161923 2004 ADAMTS4 (aggrecanase-1) interaction with the C-terminal domain of fibronectin inhibits proteolysis of aggrecan.
14744861 2004 Proprotein convertase furin interacts with and cleaves pro-ADAMTS4 (Aggrecanase-1) in the trans-Golgi network.
14715656 2004 Alpha2-macroglobulin is a novel substrate for ADAMTS-4 and ADAMTS-5 and represents an endogenous inhibitor of these enzymes.
14701864 2004 ADAMTS4 (aggrecanase-1) activation on the cell surface involves C-terminal cleavage by glycosylphosphatidyl inositol-anchored membrane type 4-matrix metalloproteinase and binding of the activated proteinase to chondroitin sulfate and heparan sulfate on syndecan-1.
14662755 2004 Altered proteolytic activities of ADAMTS-4 expressed by C-terminal processing.
14561220 2004 ADAMTS4 (aggrecanase-1) cleaves human brain versican V2 at Glu405-Gln406 to generate glial hyaluronate binding protein.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12646579 2003 Transforming growth factor-beta induces secretion of activated ADAMTS-2. A procollagen III N-proteinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12202483 2002 Autocatalytic cleavage of ADAMTS-4 (Aggrecanase-1) reveals multiple glycosaminoglycan-binding sites.
11956193 2002 Inhibition of ADAM-TS4 and ADAM-TS5 prevents aggrecan degradation in osteoarthritic cartilage.
11854269 2002 ADAMTS4 cleaves at the aggrecanase site (Glu373-Ala374) and secondarily at the matrix metalloproteinase site (Asn341-Phe342) in the aggrecan interglobular domain.
11831030 2001 [ADAMTS family--new extracellular matrix degrading enzyme].
11801682 2002 Expression and regulation of aggrecanase in arthritis: the role of TGF-beta.
11278559 2001 Versican V1 proteolysis in human aorta in vivo occurs at the Glu441-Ala442 bond, a site that is cleaved by recombinant ADAMTS-1 and ADAMTS-4.
11254106 2000 Characterization of 5'-flanking region of human aggrecanase-1 (ADAMTS4) gene.
11167130 2001 ADAMTS: a novel family of extracellular matrix proteases.
10986281 2000 Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.
10827174 2000 The thrombospondin motif of aggrecanase-1 (ADAMTS-4) is critical for aggrecan substrate recognition and cleavage.
10801887 2000 Brain-enriched hyaluronan binding (BEHAB)/brevican cleavage in a glioma cell line is mediated by a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS) family member.
10751421 2000 Sites of aggrecan cleavage by recombinant human aggrecanase-1 (ADAMTS-4).
10464288 1999 ADAM-TS5, ADAM-TS6, and ADAM-TS7, novel members of a new family of zinc metalloproteases. General features and genomic distribution of the ADAM-TS family.
10438522 1999 Cloning and characterization of ADAMTS11, an aggrecanase from the ADAMTS family.
10356395 1999 Purification and cloning of aggrecanase-1: a member of the ADAMTS family of proteins.
10094461 1999 ADAMTS: a novel family of proteases with an ADAM protease domain and thrombospondin 1 repeats.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.