Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.23
PubTator Score 6.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Liver neoplasms 108
Disease Target Count P-value
ovarian cancer 8491 3.1e-08
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
osteosarcoma 7933 0.0 1.0
Disease Target Count Z-score Confidence
Weill-Marchesani syndrome 14 6.061 3.0
Tracheal stenosis 18 3.325 1.7
Disease Target Count
Weill-Marchesani-Like Syndrome 2

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.706 4.6e-04
ovarian cancer -1.500 3.1e-08

Gene RIF (11)

PMID Text
24940034 The mutation in the Weill-Marchesani syndrome (WMS)- gene ADAMTS17 also causes WMS in an Indian family.
24940034 A mutation in WMS-like gene ADAMTS17 also causes WMS.
24906090 higher Adamts17 expression is found in several human cancer cell subtypes, especially in breast ductal carcinoma and there is an inverse correlation between higher Adamts17 expression and patients' survival.
23661674 Endothelial protease nexin-1 is a novel regulator of A disintegrin and metalloproteinase 17 maturation and endothelial protein C receptor shedding via furin inhibition.
22486325 Recessive ADAMTS17 mutations are a recurrent cause of isolated spherophakia with short stature.
21555518 ADAMTS17 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21037509 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
19836009 Homozygous mutation in ADAMTS17 causes lenticular myopia, ectopia lentis, glaucoma, spheropakia, and short stature.
19266077 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCDGALLPPLVLPVLLLLVWGLDPGTAVGDAAADVEVVLPWRVRPDDVHLPPLPAAPGPRRRRRPRTPPA      1 - 70
APRARPGERALLLHLPAFGRDLYLQLRRDLRFLSRGFEVEEAGAARRRGRPAELCFYSGRVLGHPGSLVS     71 - 140
LSACGAAGGLVGLIQLGQEQVLIQPLNNSQGPFSGREHLIRRKWSLTPSPSAEAQRPEQLCKVLTEKKKP    141 - 210
TWGRPSRDWRERRNAIRLTSEHTVETLVVADADMVQYHGAEAAQRFILTVMNMVYNMFQHQSLGIKINIQ    211 - 280
VTKLVLLRQRPAKLSIGHHGERSLESFCHWQNEEYGGARYLGNNQVPGGKDDPPLVDAAVFVTRTDFCVH    281 - 350
KDEPCDTVGIAYLGGVCSAKRKCVLAEDNGLNLAFTIAHELGHNLGMNHDDDHSSCAGRSHIMSGEWVKG    351 - 420
RNPSDLSWSSCSRDDLENFLKSKVSTCLLVTDPRSQHTVRLPHKLPGMHYSANEQCQILFGMNATFCRNM    421 - 490
EHLMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVSKTPIPEHVDGDWSPWGAWSMCSRTCG    491 - 560
TGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDD    561 - 630
KPCELYCSPLGKESPLLVADRVLDGTPCGPYETDLCVHGKCQKIGCDGIIGSAAKEDRCGVCSGDGKTCH    631 - 700
LVKGDFSHARGTALKDSGKGSINSDWKIELPGEFQIAGTTVRYVRRGLWEKISAKGPTKLPLHLMVLLFH    701 - 770
DQDYGIHYEYTVPVNRTAENQSEPEKPQDSLFIWTHSGWEGCSVQCGGGERRTIVSCTRIVNKTTTLVND    771 - 840
SDCPQASRPEPQVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRP    841 - 910
AAVQSCEGQDCLSIWEASEWSQCSASCGKGVWKRTVACTNSQGKCDASTRPRAEEACEDYSGCYEWKTGD    911 - 980
WSTCSSTCGKGLQSRVVQCMHKVTGRHGSECPALSKPAPYRQCYQEVCNDRINANTITSPRLAALTYKCT    981 - 1050
RDQWTVYCRVIREKNLCQDMRWYQRCCQTCRDFYANKMRQPPPNS                            1051 - 1095
//

Text Mined References (19)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24940034 2014 Whole exome sequencing identifies a novel splice-site mutation in ADAMTS17 in an Indian family with Weill-Marchesani syndrome.
24906090 2014 Sp1 is necessary for gene activation of Adamts17 by estrogen.
23727862 2013 Genome-wide association study identifies two susceptibility loci for osteosarcoma.
23661674 2013 Endothelial protease nexin-1 is a novel regulator of A disintegrin and metalloproteinase 17 maturation and endothelial protein C receptor shedding via furin inhibition.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22486325 2012 Familial spherophakia with short stature caused by a novel homozygous ADAMTS17 mutation.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21037509 2010 Variants of ADAMTS1 modify the effectiveness of statins in reducing the risk of myocardial infarction.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
19836009 2009 Homozygous mutations in ADAMTS10 and ADAMTS17 cause lenticular myopia, ectopia lentis, glaucoma, spherophakia, and short stature.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11867212 2002 Cloning, expression analysis, and structural characterization of seven novel human ADAMTSs, a family of metalloproteinases with disintegrin and thrombospondin-1 domains.