Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.02
PubTator Score 5.97

Knowledge Summary


No data available


  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 3.6e-05
glioblastoma 1.900 3.5e-03
pediatric high grade glioma 1.600 2.5e-03
pilocytic astrocytoma 1.400 3.1e-05
posterior fossa group A ependymoma 1.500 7.8e-05
invasive ductal carcinoma -1.994 4.8e-03

Gene RIF (7)

25649796 ADAMTS15 is a candidate gene for intracranial aneurysms
25099234 ADAMTS-15 has multiple actions on tumor pathophysiology including modulation of cell-extracellular matrix interactions, which likely involve syndecan-4.
23233679 Versican processing by ADAMTS5 and ADAMTS15 contribute to muscle fiber formation.
20590445 ADAMTS-15 but not ADAMTS-1 expression was downregulated by androgen in LNCaP prostate cancer cells, possibly through androgen response elements associated with the gene
19458070 ADAMTS15 may be target of inactivating mutations in human cancer.
16152618 ADAMTS8 and ADAMTS15 have emerged as novel predictors of survival in patients with breast carcinoma
15599946 negative effect of TGFbeta1 on ADAMTS-1, -5, -9, and -15 coupled with increases in their inhibitor, TIMP-3 may aid the accumulation of versican in the stromal compartment of the prostate in BPH and prostate cancer

AA Sequence

RGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC                                  911 - 950

Text Mined References (13)

PMID Year Title
26870338 2016 ADAMTS13 and 15 are not regulated by the full length and N-terminal domain forms of TIMP-1, -2, -3 and -4.
25649796 2015 Genetic study of intracranial aneurysms.
25099234 2015 Metalloproteinase-dependent and -independent processes contribute to inhibition of breast cancer cell migration, angiogenesis and liver metastasis by a disintegrin and metalloproteinase with thrombospondin motifs-15.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23233679 2013 Versican processing by a disintegrin-like and metalloproteinase domain with thrombospondin-1 repeats proteinases-5 and -15 facilitates myoblast fusion.
20590445 2010 Androgen regulates ADAMTS15 gene expression in prostate cancer cells.
19458070 2009 Genetic inactivation of ADAMTS15 metalloprotease in human colorectal cancer.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16152618 2006 ADAMTS8 and ADAMTS15 expression predicts survival in human breast carcinoma.
15599946 2005 The expression and regulation of ADAMTS-1, -4, -5, -9, and -15, and TIMP-3 by TGFbeta1 in prostate cells: relevance to the accumulation of versican.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11867212 2002 Cloning, expression analysis, and structural characterization of seven novel human ADAMTSs, a family of metalloproteinases with disintegrin and thrombospondin-1 domains.