Property Summary

NCBI Gene PubMed Count 75
PubMed Score 263.74
PubTator Score 212.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Alzheimer Disease 10

Expression

  Differential Expression (32)

Disease log2 FC p
Down syndrome 2.100 1.3e-03
malignant mesothelioma -1.700 1.0e-07
osteosarcoma 2.038 1.0e-02
medulloblastoma, large-cell -1.500 2.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.496 4.9e-03
Amyotrophic Lateral Sclerosis 1.275 5.6e-05
acute quadriplegic myopathy 1.748 1.3e-04
adrenocortical adenoma -1.539 4.4e-02
adrenocortical carcinoma -2.034 2.2e-05
primary pancreatic ductal adenocarcinoma 1.023 1.0e-02
non-small cell lung cancer -1.864 2.2e-12
intraductal papillary-mucinous adenoma (... -3.600 8.6e-05
intraductal papillary-mucinous carcinoma... -3.900 6.2e-05
intraductal papillary-mucinous neoplasm ... -3.900 6.5e-04
Hydrolethalus syndrome 1.519 3.9e-02
colon cancer -2.700 5.5e-03
lung cancer -2.900 3.0e-06
lung adenocarcinoma -2.000 1.4e-07
atypical teratoid/rhabdoid tumor 1.300 3.2e-02
group 4 medulloblastoma -1.200 5.6e-03
posterior fossa group B ependymoma -1.300 5.0e-04
invasive ductal carcinoma -1.546 1.1e-02
psoriasis -1.800 9.6e-08
Endometriosis -1.050 2.2e-02
Breast cancer -2.400 1.1e-07
lung carcinoma -1.300 5.5e-06
breast carcinoma -1.500 1.0e-17
gastric carcinoma 2.500 2.4e-03
ductal carcinoma in situ -1.100 2.3e-03
ulcerative colitis 2.600 2.1e-05
pituitary cancer -2.500 8.2e-06
pancreatic cancer 1.100 1.0e-02

Gene RIF (61)

PMID Text
26916548 progesterone acts via the progesterone receptor to modulate ADAMTS 1 and 4 levels in ovarian cancer cell lines.
26675551 High ADAMTS1 expression was significantly associated with tumorigenicity of Kaposi's sarcoma-associated herpesvirus infected endothelial cells.
26663063 Data suggest that the rs416905 and rs402007 single nucleotide polymorphisms of the a disintegrin and metallo-proteinase with thrombospondin type 1 motifs (ADAMTS-1) gene may be associated with ischemic stroke caused by large artery atherosclerosis (LAA).
26563155 increased expression of ADAMTS1 protein in macrophages and neutrophils that infiltrated aortic tissues may promote the progression of acute aortic dissection
26299656 Ectopic expression of SP1 and USF transcription factors resulted in the decrease in ADAMTS1 transcriptional activity of all promoter constructs
26124221 single-nucleotide missense mutation in the ADAMTS1 gene (c. 742I>T) was found to segregate in the family, given that the affected individuals must be heterozygous for the mutation
25998153 Results show that ADAMTS1 expression is negatively regulated in breast neoplasm cells due to mir-365 targeting its 3'UTR.
25936341 The aberrant methylation of ADAMTS1 may be involved in the development and progression of gastric cancer.
24998958 Data show that ADAMTS1 was expressed at a significantly higher level in extravillous trophoblast cells (EVTs) than in villous trophoblast cells (VTs), while both ADAM10 and ADAM12 were expressed at significantly higher levels in VTs than in EVTs.
24646063 Dysregulated expression of ADAMTS-1 in polycystic ovary syndrome may influence oocyte quality-via Granulosa cells-oocyte paracrine and endocrine mechanism.
24631293 ADAMTS1 formed a complex with VEGFC, attenuated VEGFR3 phosphorylation and inhibited lymphangiogenesis in vitro.
23859810 We have demonstrated that the expression of ADAMTS-1, -4 and -5 is induced during the differentiation of monocytes into macrophages.
23681936 ADAMTS1 expression is decreased in breast tumor specimens.
23289900 ADAMTS-1 expression was decreased in human breast tumors, and ADAMTS-1 knockdown stimulated migration, invasion and invadopodia formation in breast cancer cells in vitro.
23001403 These findings suggest that ADAMTS1 expression is altered in primary gastric cancer and paired lymph node metastasis and has angioinhibitory effects.
22776012 our results demonstrated that ADAMTS1 gene transfer inhibited angiogenesis in vitro and in vivo
22735305 study showed that ADAMTS-1, -4, -5 and TIMP3 were expressed at differential levels in hepatocellular carcinoma cell lines
22562232 Data show that the expression of ADAMTS4, 9, 16 and was up-regulated during chondrogenesis, ADAMTS1 and 5 were down-regulated.
22383695 Pericyte-derived TIMP3 stabilized and ADAMTS1 destabilized the capillary tubular networks
21937160 variable effects that chemical modifications/mutations in vWF have on proteolysis by ADAMTS13
21345877 ADAMTS-1 was present in human coronary atherosclerotic plaques; ADAMDTS-1 was differentially expressed between acute myocardial infarction and stable angina; and ADAMTS-1 immunopositive cells were mainly macrophages.
21037509 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20840749 ADAMTS1 expression is elevated in endometrial adenocarcinoma
20795945 AHR, a novel acute hypoxia-response sequence, drives reporter gene expression under hypoxia in vitro and in vivo.
20655981 The correlation between its expression in cumulus granulosa cells and oocyte fertilization capacity suggests a role for ADAMTS-1 in human cumulus function
20546609 ADAMTS1 is an important regulatory factor of angiogenesis and tumor growth in prostate tumors, where modified ADAMTS1 expression resulted in markedly changed blood vessel morphology, possibly related to altered thrombospondin 1 levels.
20484033 Study documents the expression of ADAMTS1 in aggressive and highly plastic melanoma and Ewing sarcoma cells. Inhibiting ADAMTS1 compromised the endothelial mimetic attributes observed.
20103648 results indicate that the antiangiogenic activity of TSP1 is differentially regulated by ADAMTS1 in the liver and lung, emphasizing the concept that regulation of angiogenesis is varied in different tissue environments.
19915008 cleavage of semaphorin 3C induced by ADAMTS1 promotes the migration of breast cancer cells, indicating that the co-expression of these molecules in tumors may contribute to the metastatic program
19608765 disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS1) and matrix metalloproteinase-1 (MMP1), orchestrate a paracrine signaling cascade to modulate the bone microenvironment in favor of osteoclastogenesis and bone metastasis
19404339 These results demonstrate that the ADAMTS1 3'-untranslated region may regulate the stability and expression of ADAMTS1 mRNA.
19349275 ADAMTS1 is transiently induced by hypoxia in endothelial cells, and its transcription is mediated by HIF-1 binding
19027488 results suggest that aberrant methylation of ADAMTS1 frequently occurs in non-small cell lung cancer (NSCLC), and that it may play a role in the pathogenesis of NSCLC
19023099 Observational study of gene-disease association. (HuGE Navigator)
19010931 catalytically active ADAMTS-1 contribution to tumor development, which consists of the recruitment of fibroblasts involved in tumor growth and tumor-associated stroma remodeling.
19007777 These data suggest the involvement of HDAC6 and SP1 in the HDACi-induced expression of angiostatic ADAMTS1.
18775505 ADAMTS1 proteolytic action mimics the outcome of genetic deletion of this proteoglycan with regards to focal adhesion. Findings suggest that the shedding of syndecan-4 by ADAMTS1 disrupts cell adhesion and promotes cell migration.
18192475 ADAMTS-1 was significantly upregulated in thrombosed hemodialysis grafts.
18174457 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18076023 Expression of several genes associated with angiogenesis was altered during transition into androgen-independency. Among these, a significant decrease was found for ADAMTS1, whose expression inversely correlated with microvessel density.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17897672 Results show that crystal structures contain catalytic and disintegrin-like domains, both in the inhibitor-free form and in complex with the inhibitor marimastat.
17560840 These results show that ADAMTS-1 has both the opportunity in bone and capability in vitro to induce collagen type I processing, together with a positive influence on osteoblastic three-dimensional growth.
17167179 Hypermethylation was subsequently identified for three of four analyzed genes, ADAMTS1 (85%), CRABP1 (90%), and NR3C1 (35%).
16675485 ADAMTS-1 expression is associated with decidualization of the endometrial stroma in vivo. IL-1beta increased whereas TGF-beta1 decreased ADAMTS-1 mRNA and protein levels in decidual stromal cell cultures in a concentration- and time-dependent manner.
16641089 role of TFPI-2 as a maintenance factor of extracellular remodeling suggests the indirect function of ADAMTS1 as an additional homeostatic player by its ability to alter the extracellular location of TFPI-2
16495931 results provide evidence for an overexpression of ADAM-12 and a lower expression of ADAMTS-1 in non-small-cell lung cancer suggest that these proteases play different functions in cancer progression
16328961 Has a previously unreported gelatinolytic activity.
16314835 Overexpression of ADAMTS-1 promotes pulmonary metastasis of mammary carcinoma and Lewis lung carcinoma cells and that a proteinase-dead mutant of ADAMTS-1 inhibits their metastasis
16061471 fibulin-1 is a new regulator of ADAMTS-1-mediated proteoglycan proteolysis and may play an important role in proteoglycan turnover in tissues where there is overlapping expression
15967414 Expression of ADAMTS1 was downregulated by cAMP in normal, but not in SV40-transformed cells, suggesting that in normal cells epiregulin and amphiregulin activity is downregulated by a feedback mechanism that may be lost in SV40-transformed cells
15878613 specific distribution pattern of ADAMTS-1 in a variety of organs during embryogenesis suggests a role of the molecule in tissue remodelling, vasculogenesis and angiogenesis
15661359 ADAMTS-1-immunoreactivity was manifold increased in brain with Down syndrome and neurodegeneration.
15599946 negative effect of TGFbeta1 on ADAMTS-1, -5, -9, and -15 coupled with increases in their inhibitor, TIMP-3 may aid the accumulation of versican in the stromal compartment of the prostate in BPH and prostate cancer
15184385 results suggest that conserved residues other than the furin cleavage site in the prodomain of a disintegrin and metalloprotease with thrombospondin type I motif(ADAMTS-1) are involved in its biosynthesis
14996435 ADAMTS-1 expression was significantly reduced in the presence of HDL subfraction 3.
14760803 ADAMTS-1 is the first matrix-degrading enzyme downregulated by the catabolic factor IL-1beta in vitro.
12716911 ADAMTS1 significantly blocks VEGFR2 phosphorylation due to direct binding and sequestration of VEGF165, with consequent suppression of endothelial cell proliferation.
12054629 cleaves aggrecan at multiple sites and is differentially inhibited by metalloproteinase inhibitors
12054626 properties investigated through protein engineering
11831030 extracellular matrix degrading enzyme

AA Sequence

MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEELVVPELERAPG      1 - 70
HGTTRLRLHAFDQQLDLELRPDSSFLAPGFTLQNVGRKSGSETPLPETDLAHCFYSGTVNGDPSSAAALS     71 - 140
LCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAPLQFHLLRRNRQGDVGGTCGVVDDEPRPTGK    141 - 210
AETEDEDEGTEGEDEGAQWSPQDPALQGVGQPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKH    211 - 280
YLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHY    281 - 350
DTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL    351 - 420
NGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGTSYDANRQCQF    421 - 490
TFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRKHFDTPFHG    491 - 560
SWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNLEDCPDNNGKTFREEQCEAHN    561 - 630
EFSKASFGSGPAVEWIPKYAGVSPKDRCKLICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAG    631 - 700
CDRIIDSKKKFDKCGVCGGNGSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAI    701 - 770
KAADGTYILNGDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY    771 - 840
FVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPASTRPCADHPCP    841 - 910
QWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS                 911 - 967
//

Text Mined References (76)

PMID Year Title
26916548 2016 Progesterone acts via the progesterone receptor to induce adamts proteases in ovarian cancer cells.
26675551 2016 CD147 and downstream ADAMTSs promote the tumorigenicity of Kaposi's sarcoma-associated herpesvirus infected endothelial cells.
26663063 2015 [Association of ADAMTS-1 gene polymorphisms with ischemic stroke caused by large artery atherosclerosis].
26563155 2016 A disintegrin and metalloproteinase with thrombospondin motif 1 (ADAMTS1) expression increases in acute aortic dissection.
26299656 2016 SP1 and USF differentially regulate ADAMTS1 gene expression under normoxic and hypoxic conditions in hepatoma cells.
26124221 2015 The ADAMTS1 Gene Is Associated with Familial Mandibular Prognathism.
25998153 2015 miR?365 overexpression promotes cell proliferation and invasion by targeting ADAMTS-1 in breast cancer.
25936341 2015 Downregulation of A disintegrin and metallopeptidase with thrombospondin motif type 1 by DNA hypermethylation in human gastric cancer.
24998958 2014 Differential expression of ADAM (a disintegrin and metalloproteinase) genes between human first trimester villous and extravillous trophoblast cells.
24646063 2014 Evidence for decreased expression of ADAMTS-1 associated with impaired oocyte quality in PCOS patients.
24631293 2014 ADAMTS1 inhibits lymphangiogenesis by attenuating phosphorylation of the lymphatic endothelial cell-specific VEGF receptor.
23859810 2013 Regulation of ADAMTS-1, -4 and -5 expression in human macrophages: differential regulation by key cytokines implicated in atherosclerosis and novel synergism between TL1A and IL-17.
23681936 2013 Contribution of ADAMTS1 as a tumor suppressor gene in human breast carcinoma. Linking its tumor inhibitory properties to its proteolytic activity on nidogen-1 and nidogen-2.
23289900 2013 Decreased expression of ADAMTS-1 in human breast tumors stimulates migration and invasion.
23001403 2013 Expression of ADAMTS1 and its correlation with angiogenesis in primary gastric cancer and lymph node metastasis.
22776012 2012 Tumor growth inhibitory effect of ADAMTS1 is accompanied by the inhibition of tumor angiogenesis.
22735305 2012 Expression of ADAMTS-1, ADAMTS-4, ADAMTS-5 and TIMP3 by hepatocellular carcinoma cell lines.
22562232 2012 Regulation of aggrecanases from the ADAMTS family and aggrecan neoepitope formation during in vitro chondrogenesis of human mesenchymal stem cells.
22383695 2012 Pericyte TIMP3 and ADAMTS1 modulate vascular stability after kidney injury.
21937160 2012 Modeling ADAMTS13-von Willebrand factor interaction: Implications for oxidative stress-related cardiovascular diseases and type 2A von Willebrand disease.
21345877 2011 Comparison of ADAMTS-1, -4 and -5 expression in culprit plaques between acute myocardial infarction and stable angina.
21037509 2010 Variants of ADAMTS1 modify the effectiveness of statins in reducing the risk of myocardial infarction.
20840749 2010 PGF2?-F-prostanoid receptor signalling via ADAMTS1 modulates epithelial cell invasion and endothelial cell function in endometrial cancer.
20795945 2011 AHR, a novel acute hypoxia-response sequence, drives reporter gene expression under hypoxia in vitro and in vivo.
20655981 2010 ADAMTS-1: a new human ovulatory gene and a cumulus marker for fertilization capacity.
20546609 2010 ADAMTS1 alters blood vessel morphology and TSP1 levels in LNCaP and LNCaP-19 prostate tumors.
20484033 2010 ADAMTS1 contributes to the acquisition of an endothelial-like phenotype in plastic tumor cells.
20103648 2010 Variable inhibition of thrombospondin 1 against liver and lung metastases through differential activation of metalloproteinase ADAMTS1.
19915008 2010 The cleavage of semaphorin 3C induced by ADAMTS1 promotes cell migration.
19608765 2009 ADAMTS1 and MMP1 proteolytically engage EGF-like ligands in an osteolytic signaling cascade for bone metastasis.
19404339 2009 The 3'-untranslated region of ADAMTS1 regulates its mRNA stability.
19349275 2009 ADAMTS1 is a unique hypoxic early response gene expressed by endothelial cells.
19027488 2008 Aberrant methylation of ADAMTS1 in non-small cell lung cancer.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
19010931 2008 ADAMTS-1 metalloproteinase promotes tumor development through the induction of a stromal reaction in vivo.
19007777 2008 HDAC inhibition upregulates the expression of angiostatic ADAMTS1.
18775505 2009 Cleavage of syndecan-4 by ADAMTS1 provokes defects in adhesion.
18192475 2008 Increased expression of a disintegrin and metalloproteinase thrombospondin 1 in thrombosed hemodialysis grafts.
18174457 2008 Association between ADAMTS1 matrix metalloproteinase gene variation, coronary heart disease, and benefit of statin therapy.
18076023 2008 Altered expression of genes regulating angiogenesis in experimental androgen-independent prostate cancer.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897672 2007 Crystal structures of human ADAMTS-1 reveal a conserved catalytic domain and a disintegrin-like domain with a fold homologous to cysteine-rich domains.
17560840 2007 ADAMTS-1 increases the three-dimensional growth of osteoblasts through type I collagen processing.
17167179 2006 ADAMTS1, CRABP1, and NR3C1 identified as epigenetically deregulated genes in colorectal tumorigenesis.
16675485 2006 Differential effects of interleukin-1beta and transforming growth factor-beta1 on the expression of the inflammation-associated protein, ADAMTS-1, in human decidual stromal cells in vitro.
16641089 2006 ADAMTS1 interacts with, cleaves, and modifies the extracellular location of the matrix inhibitor tissue factor pathway inhibitor-2.
16495931 2006 Expression of a disintegrin and metalloprotease (ADAM and ADAMTS) enzymes in human non-small-cell lung carcinomas (NSCLC).
16328961 2006 Purification of an insect derived recombinant human ADAMTS-1 reveals novel gelatin (type I collagen) degrading activities.
16314835 2006 Full-length ADAMTS-1 and the ADAMTS-1 fragments display pro- and antimetastatic activity, respectively.
16061471 2005 Fibulin-1 acts as a cofactor for the matrix metalloprotease ADAMTS-1.
15967414 2005 Differential expression of genes coding for EGF-like factors and ADAMTS1 following gonadotropin stimulation in normal and transformed human granulosa cells.
15878613 2005 Distribution patterns of the anti-angiogenic protein ADAMTS-1 during rat development.
15661359 2005 Metalloproteinase ADAMTS-1 but not ADAMTS-5 is manifold overexpressed in neurodegenerative disorders as Down syndrome, Alzheimer's and Pick's disease.
15599946 2005 The expression and regulation of ADAMTS-1, -4, -5, -9, and -15, and TIMP-3 by TGFbeta1 in prostate cells: relevance to the accumulation of versican.
15184385 2004 Identification of prodomain determinants involved in ADAMTS-1 biosynthesis.
14996435 2004 High-density lipoprotein subfraction 3 decreases ADAMTS-1 expression induced by lipopolysaccharide and tumor necrosis factor-alpha in human endothelial cells.
14760803 2004 ADAMTS-1, a gene product of articular chondrocytes in vivo and in vitro, is downregulated by interleukin 1beta.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12907688 2003 Processing and localization of ADAMTS-1 and proteolytic cleavage of versican during cumulus matrix expansion and ovulation.
12716911 2003 ADAMTS1/METH1 inhibits endothelial cell proliferation by direct binding and sequestration of VEGF165.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054629 2002 ADAMTS1 cleaves aggrecan at multiple sites and is differentially inhibited by metalloproteinase inhibitors.
12054626 2002 Protein engineering and properties of human metalloproteinase and thrombospondin 1.
11831030 2001 [ADAMTS family--new extracellular matrix degrading enzyme].
11278559 2001 Versican V1 proteolysis in human aorta in vivo occurs at the Glu441-Ala442 bond, a site that is cleaved by recombinant ADAMTS-1 and ADAMTS-4.
10930576 2000 ADAMTS-1 cleaves a cartilage proteoglycan, aggrecan.
10830953 2000 The DNA sequence of human chromosome 21.
10811842 2000 ADAMTS-1: a metalloproteinase-disintegrin essential for normal growth, fertility, and organ morphology and function.
10785405 2000 Differential gene expression by endothelial cells in distinct angiogenic states.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
10438512 1999 METH-1, a human ortholog of ADAMTS-1, and METH-2 are members of a new family of proteins with angio-inhibitory activity.
10373500 1999 ADAMTS-1 is an active metalloproteinase associated with the extracellular matrix.
10094461 1999 ADAMTS: a novel family of proteases with an ADAM protease domain and thrombospondin 1 repeats.
9593739 1998 ADAMTS-1 protein anchors at the extracellular matrix through the thrombospondin type I motifs and its spacing region.
8995297 1997 Molecular cloning of a gene encoding a new type of metalloproteinase-disintegrin family protein with thrombospondin motifs as an inflammation associated gene.