Property Summary

NCBI Gene PubMed Count 74
PubMed Score 113.56
PubTator Score 108.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis 1.300 9.8e-03
gastric cancer -1.100 3.7e-02
psoriasis 1.100 9.2e-04
glioblastoma 2.600 4.9e-04
osteosarcoma 3.436 2.6e-04
ependymoma 1.800 9.5e-08
astrocytoma 1.500 3.9e-02
atypical teratoid / rhabdoid tumor 2.000 3.0e-04
group 4 medulloblastoma -1.200 6.2e-03
medulloblastoma, large-cell -1.200 2.4e-03
acute quadriplegic myopathy 1.281 1.4e-05
primary pancreatic ductal adenocarcinoma 1.594 2.0e-03
non-small cell lung cancer 1.094 3.4e-05
intraductal papillary-mucinous adenoma (... 1.800 3.2e-02
intraductal papillary-mucinous neoplasm ... 1.200 2.9e-03
lung cancer -1.200 8.7e-03
active Crohn's disease 1.373 1.4e-03
active ulcerative colitis 1.324 9.3e-04
pancreatic cancer 1.800 3.7e-06
pediatric high grade glioma 1.800 1.3e-03
pilocytic astrocytoma 1.900 1.7e-04
aldosterone-producing adenoma -1.319 5.0e-02
progressive supranuclear palsy -1.300 6.4e-03
invasive ductal carcinoma 1.300 9.3e-03
ovarian cancer -1.900 4.0e-04
dermatomyositis 1.600 2.2e-03

 CSPA Cell Line (3)

Protein-protein Interaction (1)

Gene RIF (57)

PMID Text
26592768 Activation of ERalpha but not ERbeta increases ADAM9 expression in cultured human neuronal cells.
26553452 ADAM9 enhances CDCP1 protein expression by suppressing miR-218 for lung tumor metastasis
26507842 ADAM9 and ROS1 are direct downstream targets of miR-33a
26261534 miR-126 may act as a tumor suppressor via inhibition of cell invasion by downregulating ADAM9 in breast cancer development.
26179263 results suggested that miR-203 played tumor suppressive roles by downregulating ADAM9 and HULC and indicated its potential application in cancer treatment
25778452 ADAM9 silencing inhibits the tumor growth of non-small lung cancer in vitro and in vivo.
25646025 This study has identified tenascin-C as a promoter of the invasiveness of brain tumor-initiating cells through a mechanism involving ADAM-9 proteolysis via the c-Jun NH2-terminal kinase pathway.
25546566 Whole exome sequencing was performed, which identified a novel, homozygous mutation in ADAM9, c.967delT; p.Ser323Glnfs*33.
25344581 ADAM9 plays an important role in gastric cancer proliferation and invasion, and that while expressed at high levels in some cancer cells that are responsive to functional inhibition and antitumor activity of a catalytic site-directed antibody.
25213697 our data indicated that miR-126 inhibits cell growth, invasion, and migration of OS cells by downregulating ADAM-9.
25177692 Given the significant correlation between tumor ADAM9 expression and serum RCAS1 concentration in both cervical and endometrial cancer as well as the role for ADAM9 in RCAS1 shedding.
25091951 We identified a novel autosomal recessive ADAM9 mutation causing autosomal recessive cone-rod dystrophy (arCRD), anterior polar and posterior subcapsular cataract in a consanguineous Egyptian family.
25063875 ADAM9 is expressed in an inducible fashion on PMN surfaces where it degrades some ECM proteins, and it promotes alveolar-capillary barrier injury during ALI
25060522 Results show how ADAM9 regulates lung cancer metastasis to the brain by facilitating the tPA-mediated cleavage of CDCP1.
24823697 this study describes the role of miR-126 in bladder cancer progression, identifying miR-126 and ADAM9 as potential clinical biomarkers of disease aggressiveness
24770635 ADAM9 high expression is correlated positively and significantly with HDGF high expression in non-small cell lung cancer.
24705471 ADAM9 up-regulates N-cadherin via miR-218 suppression in lung adenocarcinoma cells.
23857158 The expression of circulating ADAM9 is down-regulated in pulmonary sarcoidosis.
23499592 ADAM9 is an important molecule in the processes of invasion and metastasis.
23437250 miR-126&126* restored expressions play a tumor suppressor role by directly regulating ADAM9 and MMP7 in melanoma.
23429442 ADAM19 was upregulated in patients with ulcerative colitis and, to a lesser extent, in patients with Crohn's disease compared with normal controls. In contrast, ADAM9 and ADAM10 expression did not differ between patients with IBD and controls.
23405089 The over-expression of MGAM was confirmed with a 6.6 fold increase in expression at the mRNA level whereas the fold change in ADAM9 demonstrated a 1.6 fold increase.
23342005 a novel molecular mechanism of ADAM9 in the regulation of prostate cancer cell proliferation.
23106877 ADAM9 expression was low in castration resistant prostate cancer (CRPC), correlated with poor prognosis and might be involved in the succession from hormonal sensitive prostate cancer (HSPC) to CRPC by various functions.
22480688 Transient transfection of ADAM9 and ACE cDNAs into HEK293 cells demonstrated that ADAM9 requires both membrane anchorage and its catalytic domain to shed ACE.
22064652 The miR-126/ADAM9 axis plays essential role in the inhibition of invasive growth of pancreatic cancer cells.
21956108 ADAM10 activity is regulated by inhibition of ADAM9, and this regulation may be used to control shedding of amyloid precursor protein by enhancing alpha-secretase activity, a key regulatory step in the etiology of Alzheimer disease
21135106 ADAM-9 expression plays an important role in mediating cell-cell contacts between fibroblasts and melanoma cells and that these interactions contribute to proteolytic activities required during invasion of melanoma cells.
20736367 Secreted variants of ADAM9 are a key determinant in manifestation of aggressive migratory phenotypes associated with breast cancer progression.
20672324 ADAM9 plays a crucial role in prostate cancer progression and therapeutic resistance in part by altering E-cadherin and integrin expression.
20422344 is expressed in adenoid cystic carcinoma-associated metastasis
20388695 disintegrin and metalloprotease-9 is overexpressed in hepatocellular carcinoma and can be used as a prognostic marker
19564338 Experiments revealed that ADAM9 and ADAM10, but not ADAM17, are involved in the shedding of PrP(C) and that ADAM9 exerts its effect on PrP(C) shedding via ADAM10.
19543729 Data show that the expression levels MMP1, MMP9, ADAM9 and TIMP3 were altered in drug-resistant sublines.
19505527 the role of the disintegrin domain of the human ADAM9 (ADAM9D) on the adhesion of breast tumor cells and platelets to collagen I
19473694 ADAM9 expression is low in the squamous epithelium of the cervix, but is increased in CIN3 lesions as well as SCCs being the increase in both cases statistically significant.
19409519 ADAM9 is a CRD gene and also is a form of pathology wherein retinal disease first manifests at the POS-RPE junction.
19394555 Cell migration in response to the amino-terminal fragment of urokinase requires epidermal growth factor receptor activation through an ADAM9/10-mediated mechanism.
19253070 involved in advanced atherosclerosis, in catalytically active form, most notably associated with cells of monocytic origin
19237226 The data of this suggested that promoter polymorphisms which regulate ADAM9 transcription are protective against SAD.
19237226 Observational study of gene-disease association. (HuGE Navigator)
19003995 ADAM9 plays a crucial role in UV-induced EGFR activation and is overexpressed in skin cancer cell lines
18061337 ADAM9 is overexpressed in prostate cancer cases and is an independent prognostic marker of PSA relapse-free survival following radical prostatectomy.
17704059 the ADAM-9 adhesive domain plays a role in regulating the motility of cells by interaction with beta1 integrins and modulates MMP synthesis.
17342749 These findings suggest that reactive oxygen species is a common mediator responsible for ADAM9 protein induction in human prostate cancer cells, downstream from androgen receptor, and stress response signaling.
17018608 Intracellular ROS and/or hydrogen peroxide, generated by cell stress, regulate ADAM9 expression. ADAM9 may support prostate cancer cell survival and progression.
16806063 ADAM9 does not behave as a genuine alpha-secretase but rather acts as an important upstream regulator of ADAM10 activity.
16311053 In conclusion, our findings are consistent with the hypothesis that FHL-2 and ADAM-9 are important modulators of IGFBP-5 actions and are, in part, regulated in a coordinated manner in bone
15856464 In melanoma ADAM-9 protein expression appeared to be restricted to the melanoma cells within the invading front.
15205330 ADAM9 overexpression enhances cell adhesion and invasion of non-small cell lung cancer cells via modulation of other adhesion molecules and changes in sensitivity to growth factors, thereby promoting metastatic capacity to the brain.
14997207 Cytoplasmic ADAM9 overexpression is associated with poor differentiation in ductal adenocarcinoma
12767059 Expression of ADAM-9 mRNA and protein in human breast cancer.
12535668 The results indicate that ADAM9, ADAM10, and ADAM17, members of the disintegrin and metalloprotease family, catalyze alpha-secretory cleavage and therefore act as alpha-secretases in A172 cells.
12484779 First evidence is presented of ADAM9 as an insulin-like growth factor binding protein-5 (IGFBP-5) protease produced and secreted by osteoblasts in culture, able to degrade IGFBP-5 with high potency, thereby regulating the critical activity of IGFBP-5.
12054541 cloning of a novel form of human ADAM9 (hADAM9s) which has an alpha-secretase activity for Amyloid Protein Precursor
11955914 The downregulated expression of ADAM9 may serve as a marker for anterior polar cataracts.
11831872 ADAM9 is involved in monocyte fusion.

AA Sequence

MGSGARFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVI      1 - 70
QAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLL     71 - 140
HLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQ    141 - 210
TRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDV    211 - 280
LGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELG    281 - 350
HNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK    351 - 420
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSECDVPEYCNGSS    421 - 490
QFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCFIEVNSKGDRFGNCGFSGNEY    491 - 560
KKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKCWGVDFQLGSDVPDPGMVNEGTKCGAGKICR    561 - 630
NFQCVDASVLNYDCDVQKKCHGHGVCNSNKNCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLL    631 - 700
VFFFLIVPLIVCAIFIFIKRDQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYA    701 - 770
NRFAVPTYAAKQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT                         771 - 819
//

Text Mined References (78)

PMID Year Title
26592768 2016 Estrogen induced the expression of ADAM9 through estrogen receptor ? but not estrogen receptor ? in cultured human neuronal cells.
26553452 2015 ADAM9 enhances CDCP1 protein expression by suppressing miR-218 for lung tumor metastasis.
26507842 2015 MiR-33a suppresses breast cancer cell proliferation and metastasis by targeting ADAM9 and ROS1.
26261534 2015 MiR-126 regulated breast cancer cell invasion by targeting ADAM9.
26179263 2016 miR-203 suppresses the proliferation and metastasis of hepatocellular carcinoma by targeting oncogene ADAM9 and oncogenic long non-coding RNA HULC.
25778452 2015 RNAi-mediated A disintegrin and metalloproteinase 9 gene silencing inhibits the tumor growth of non-small lung cancer in vitro and in vivo.
25646025 2015 ADAM-9 is a novel mediator of tenascin-C-stimulated invasiveness of brain tumor-initiating cells.
25546566 2015 Exome sequencing reveals ADAM9 mutations in a child with cone-rod dystrophy.
25344581 2014 The effect of disintegrin-metalloproteinase ADAM9 in gastric cancer progression.
25213697 2014 miR-126 inhibits cell growth, invasion, and migration of osteosarcoma cells by downregulating ADAM-9.
25177692 2014 A disintegrin and metalloproteinase 9 is involved in ectodomain shedding of receptor-binding cancer antigen expressed on SiSo cells.
25091951 2014 Novel ADAM9 homozygous mutation in a consanguineous Egyptian family with severe cone-rod dystrophy and cataract.
25063875 2014 ADAM9 is a novel product of polymorphonuclear neutrophils: regulation of expression and contributions to extracellular matrix protein degradation during acute lung injury.
25060522 2014 ADAM9 promotes lung cancer metastases to brain by a plasminogen activator-based pathway.
24823697 2014 MicroRNA-126 inhibits invasion in bladder cancer via regulation of ADAM9.
24770635 2014 HDGF and ADAM9 are novel molecular staging biomarkers, prognostic biomarkers and predictive biomarkers for adjuvant chemotherapy in surgically resected stage I non-small cell lung cancer.
24705471 2014 ADAM9 up-regulates N-cadherin via miR-218 suppression in lung adenocarcinoma cells.
23857158 2013 Serum concentrations of A disintegrin and metalloproteinase 9 (ADAM9) mRNA as a promising novel marker for the detection of pulmonary sarcoidosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23499592 2013 ADAM9 silencing inhibits breast tumor cell invasion in vitro.
23437250 2013 miR-126&126* restored expressions play a tumor suppressor role by directly regulating ADAM9 and MMP7 in melanoma.
23429442 2013 High expression of the "A Disintegrin And Metalloprotease" 19 (ADAM19), a sheddase for TNF-? in the mucosa of patients with inflammatory bowel diseases.
23405089 2013 Genome wide analysis of chromosomal alterations in oral squamous cell carcinomas revealed over expression of MGAM and ADAM9.
23342005 2013 In vivo targeting of ADAM9 gene expression using lentivirus-delivered shRNA suppresses prostate cancer growth by regulating REG4 dependent cell cycle progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23106877 2012 ADAM9 decreases in castration resistant prostate cancer and is a prognostic factor for overall survival.
22480688 2012 LPS activates ADAM9 dependent shedding of ACE from endothelial cells.
22064652 2012 MiR-126 acts as a tumor suppressor in pancreatic cancer cells via the regulation of ADAM9.
21956108 2011 ADAM9 inhibition increases membrane activity of ADAM10 and controls ?-secretase processing of amyloid precursor protein.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21135106 2011 The disintegrin-like and cysteine-rich domains of ADAM-9 mediate interactions between melanoma cells and fibroblasts.
20736367 2010 Secreted and membrane-bound isoforms of protease ADAM9 have opposing effects on breast cancer cell migration.
20672324 2011 Inhibition of ADAM9 expression induces epithelial phenotypic alterations and sensitizes human prostate cancer cells to radiation and chemotherapy.
20422344 2010 RNAi-mediated ADAM9 gene silencing inhibits metastasis of adenoid cystic carcinoma cells.
20388695 2010 Increased expression of a disintegrin and metalloprotease-9 in hepatocellular carcinoma: implications for tumor progression and prognosis.
19564338 2009 Role of ADAMs in the ectodomain shedding and conformational conversion of the prion protein.
19543729 2010 Gene expression analysis of drug-resistant MCF-7 cells: implications for relation to extracellular matrix proteins.
19505527 2009 Inhibition of platelets and tumor cell adhesion by the disintegrin domain of human ADAM9 to collagen I under dynamic flow conditions.
19473694 2009 Expression of ADAM9 in CIN3 lesions and squamous cell carcinomas of the cervix.
19409519 2009 Loss of the metalloprotease ADAM9 leads to cone-rod dystrophy in humans and retinal degeneration in mice.
19394555 2009 Cell migration in response to the amino-terminal fragment of urokinase requires epidermal growth factor receptor activation through an ADAM-mediated mechanism.
19253070 2009 ADAM-9, ADAM-15, and ADAM-17 are upregulated in macrophages in advanced human atherosclerotic plaques in aorta and carotid and femoral arteries--Tampere vascular study.
19237226 2011 Promoter polymorphisms which regulate ADAM9 transcription are protective against sporadic Alzheimer's disease.
19003995 2009 UV-induced EGFR signal transactivation is dependent on proligand shedding by activated metalloproteases in skin cancer cell lines.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18061337 2008 ADAM9 expression is a significant and independent prognostic marker of PSA relapse in prostate cancer.
17704059 2007 Role of ADAM-9 disintegrin-cysteine-rich domains in human keratinocyte migration.
17342749 2007 Reactive oxygen species mediate androgen receptor- and serum starvation-elicited downstream signaling of ADAM9 expression in human prostate cancer cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17018608 2006 Oxidative stress induces ADAM9 protein expression in human prostate cancer cells.
16806063 2006 Design and characterization of a novel cellular prion-derived quenched fluorimetric substrate of alpha-secretase.
16311053 2006 Regulation of insulin-like growth factor binding protein-5, four and a half lim-2, and a disintegrin and metalloprotease-9 expression in osteoblasts.
15856464 2005 Adam-9 expression and regulation in human skin melanoma and melanoma cell lines.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361064 2005 The disintegrin domain of ADAM9: a ligand for multiple beta1 renal integrins.
15280379 2004 ADAM binding protein Eve-1 is required for ectodomain shedding of epidermal growth factor receptor ligands.
15205330 2004 Overexpression of ADAM9 in non-small cell lung cancer correlates with brain metastasis.
14997207 2004 ADAM9 expression in pancreatic cancer is associated with tumour type and is a prognostic factor in ductal adenocarcinoma.
12767059 2003 Expression of ADAM-9 mRNA and protein in human breast cancer.
12535668 2003 Putative function of ADAM9, ADAM10, and ADAM17 as APP alpha-secretase.
12484779 2002 ADAM-9 is an insulin-like growth factor binding protein-5 protease produced and secreted by human osteoblasts.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135759 2002 The enzymatic activity of ADAM8 and ADAM9 is not regulated by TIMPs.
12054541 2002 A secreted form of human ADAM9 has an alpha-secretase activity for APP.
11955914 2002 Downregulated expression of ADAM9 in anterior polar cataracts.
11882657 2002 Functional classification of ADAMs based on a conserved motif for binding to integrin alpha 9beta 1: implications for sperm-egg binding and other cell interactions.
11831872 2001 Involvement of ADAM9 in multinucleated giant cell formation of blood monocytes.
11581183 2001 CORD9 a new locus for arCRD: mapping to 8p11, estimation of frequency, evaluation of a candidate gene.
11162558 2001 MDC-9 (ADAM-9/Meltrin gamma) functions as an adhesion molecule by binding the alpha(v)beta(5) integrin.
10531379 1999 Interaction of the metalloprotease disintegrins MDC9 and MDC15 with two SH3 domain-containing proteins, endophilin I and SH3PX1.
10527948 1999 Evidence for an interaction of the metalloprotease-disintegrin tumour necrosis factor alpha convertase (TACE) with mitotic arrest deficient 2 (MAD2), and of the metalloprotease-disintegrin MDC9 with a novel MAD2-related protein, MAD2beta.
9920899 1999 Metalloprotease-disintegrin MDC9: intracellular maturation and catalytic activity.
9857183 1998 A metalloprotease-disintegrin, MDC9/meltrin-gamma/ADAM9 and PKCdelta are involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor.
9016778 1997 Expression of members of a novel membrane linked metalloproteinase family (ADAM) in human articular chondrocytes.
8809033 1996 Cloning of a novel membrane-linked metalloproteinase from human myeloma cells.
8647900 1996 MDC9, a widely expressed cellular disintegrin containing cytoplasmic SH3 ligand domains.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.