Property Summary

NCBI Gene PubMed Count 129
PubMed Score 151.31
PubTator Score 198.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.300 3.1e-02
ependymoma 1.400 3.2e-02
oligodendroglioma 1.400 1.8e-02
osteosarcoma 1.117 4.7e-04
cystic fibrosis -1.651 1.0e-03
glioblastoma -1.200 1.9e-04
medulloblastoma, large-cell -1.500 2.2e-05
Atopic dermatitis -1.200 1.7e-03
pancreatic ductal adenocarcinoma liver m... 1.845 4.6e-04
breast carcinoma -1.200 1.0e-05
Breast cancer -3.900 2.2e-02
group 4 medulloblastoma -1.200 9.1e-04
invasive ductal carcinoma -1.752 2.3e-03
ductal carcinoma in situ -1.400 1.4e-04

Gene RIF (143)

PMID Text
26666372 findings suggest that genetic variants of ADAM33 gene may play important roles in asthma susceptibility in the Punjabi population of Pakistan
26553447 ADAM33 and ADAM12 genetic polymorphisms and their expression in Egyptian children with asthma
26291893 We investigated the influence of ADAM33 polymorphisms on the serum levels of ADAM33 and the susceptibility to pediatric asthma in the Chinese Han population
25840998 the intima+media of IPAH vessels, collagens (COL4A5, COL14A1, and COL18A1), matrix metalloproteinase (MMP) 19, and a disintegrin and metalloprotease (ADAM) 33 were higher expressed, whereas MMP10, ADAM17, TIMP1, and TIMP3 were less abundant.
25768087 a compromised ADAM33 gene may be implicated in the progression of wheeze into childhood asthma
25739290 Apparently, the investigated polymorphisms of VDBP, MMP1, ADAM33, and IL8 contribute to the genetic susceptibility to chronic bronchitis induced by dust and toxic agents.
25730038 Our results suggest that the ADAM33 V4 polymorphism increases the risk of asthma.
25453333 The results of this study suggest that these proteins play important roles in pulmonary inflammatory reactions elicited against etiological viral agents.
25369941 ADAM33 was involved in the pathogenesis of chronic obstructive pulmonary disease in an East Asian population by affecting airway inflammation and immune response.
25313536 Association between ADAM33 polymorphisms and susceptibility with adult and childhood asthma among Jordanians.
25280544 the ADAM33 T1, T2, S1, Q-1, F+1 and ST+5 six locus polymorphisms association with the risk of COPD.
25158257 A significant association was found between the T1 ADAM33 polymorphism and chronic obstructive pulmonary disease in the Chinese population in both dominant and recessive models, with no association with S2 ADAM33 polymorphism. (Meta-analysis)
25155083 The proteins identified in this study were enriched for various mechanisms that are involved in airway hyperresponsiveness, and through the interaction with ADAM33, they may have potential relevance in asthma.
25068505 A meta-analysis suggests that the ADAM33 rs528557 C>G polymorphism may contribute to susceptibility to asthma.
25036518 Results suggest that polymorphisms T1, T2, and V4 in ADAM33 may contribute to the susceptibility to asthma.
24751681 Polymorphisms in the ADAM33 gene may contribute to susceptibility of mite-sensitized persistent allergic rhinitis in the Chinese population.
24728305 ADAM33 rs628977G>A was marginally associated with a decreased risk of idiopathic pulmonary fibrosis in a recessive model.
24562625 Our data suggest that the ADAM33 polymorphisms may be associated with Psoriasis in the northeastern Chinese population
24422987 ADAM33 S1 polymorphism is a risk factor for COPD among the Chinese and smoking populations, and that Q-1 polymorphism is a risk factor for COPD among the overall populations.
24191661 Seven single nucleotide polymorphisms (SNPs) in ADAM33 were associated with chronic obstructive pulmonary disease in the Mongolian population of China. Even after Bonferroni correction, SNPs S2, S1, Q-1 and F+1 remained significant.
24141861 ADAM33 polymorphisms are correlated with asthma and may be the underlying genetic basis of the association between asthma and palm dermatoglyphic patterns.
24035932 The polymorphisms in the ADAM33 gene are associated with susceptibility to allergic rhinitis in the Jordanian population.
23902466 Meta-analysis suggested that S1 (rs3918396) polymorhism of ADAM33 is associated with increased risk of COPD in Asian (China) but not in Caucasians.
23861802 ADAM33 is a pleiotropic gene that is associated with all-cause, chronic obstructive pulmonary disease, and cardiovascular mortality, independent of potential confounders.
23640557 A higher expression of ADAM33 protein was seen in asthma patients compared to controls.
23640030 ADAM33 haplotypes (a1, a2, a3) are associated with severity of airway hyperreactivity and are significantly more often transmitted in the paternal line
23612257 The ADAM33 ST+4 polymorphism is associated with asthma in Asians.[meta-analysis]
23525950 Single nucleotide polymorphisms in ADAM33 gene is associated with the risk of adult glioma.
23380143 This meta-analysis indicates that the rs2280091, rs2787094, rs511898, rs2280090, and rs2280089 polymorphisms in the ADAM33 gene are risk factors for asthma, especially in the Asian population.
23331525 Consistent interaction between genetic variants and environmental tobacco exposures was for ADAM33 SNP rs512625 in relation to asthma severity in asthmatic children.
23257708 Experiments showed that the 14 CpG sites in exon 9 of the ADAM33 gene were highly methylated (100%) in all individuals with asthma.
23245479 Genetic polymorphism in the IL-4 promoter, ADRbeta2, and ADAM33 is associated with asthma.
22989201 SNPs, T+1, S+1 and V - 3 do not individually confer any significant risk of asthma or its severity, but haplotype analysis suggests all three polymorphisms together play an important role in the disease of asthma
22888638 The ADAM33 gene polymorphism may be an important risk factor for the development and progression of chronic obstructive pulmonary disease.
22871616 ADAM33 polymorphisms, but not S1 or ST+4, were significantly associated with asthma development in Saudi children, like those reported for white and Hispanic populations in the United States
22851202 This meta-analysis demonstrates that the ADAM33 T1 polymorphism confers susceptibility to asthma in Asians, but no association was found between the ADAM33 T2 and ST+7 polymorphisms and asthma susceptibility.
22660217 association of 11 SNPs of the ADAM33 and 6 of the STAT6 and their haplotypes with IgE levels and asthma
22583515 ADAM33 SNP rs612709 and the CCGGAAGA haplotype may be associated with asthma. Smoking may modify the associations between SNPs rs628977 and rs528557 and asthma.
22349453 Our results suggest that SNPs and haplotypes in the ADAM33 gene are associated with rhinoconjunctivitis.
22269827 ADAM33 polymorphisms are associated with psoriasis in the northeastern Chinese Han population. The rs512625AA rs612709AA GA genotypes and haplotype H8 may be protective against psoriasis.
22227561 This may provide a mechanism for fine regulation of levels of ADAM33 expression in fibroblasts, and may self-limit TGF-beta(2)-induced ectodomain shedding of ADAM33.
22035178 Polymorphisms of the ADAM33 gene associate with asthma susceptibility in the east China Han population
21930123 ADAM33 gene plays an important role in facilitating susceptibility to childhood asthma in this Han Chinese population
21869474 ADAM33 gene polymorphisms serve as genetic risk factors for asthma in Indian adult population
21781516 1,25-(OH)(2)D(3) has a direct inhibitory effect on passively sensitized human airway smooth muscle cells in vitro, including the inhibition of cell proliferation and the expressions of MMP-9 and ADAM33.
21689380 The single nucleotide polymorphisms (F+1 C/T, T2 G/A and V4 C/G) of the ADAM33 gene may be the causal variants in asthma disease.
21179102 ADAM33 gene polymorphisms may modify individual susceptibility to develop childhood asthma in the Indian population.
21161400 There is an association between ADAM33 polymorphisms and chronic obstructive pulmonary disease in Tibetan population of China.
20716621 Observational study of gene-disease association. (HuGE Navigator)
20701904 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20537279 increased expression in the mesenchymal cells of vessels of nasal polyps
20524005 Nonsignificant differences were observed for the IL-4 promoter polymorphism C589T and the ADAM33 T1 polymorphism between asthmatics and controls.
20524005 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20491578 observed a decreased frequency in the CG genotype and GG genotype of ADAM33 rs2787094 (V4) in cases compared with controls
20491578 Observational study of gene-disease association. (HuGE Navigator)
20395963 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20227692 ADAM33 has an inhibitory effect on vascular smooth muscle migration. Moreover, we detected an association between ADAM33 genotype and the extent of atherosclerosis in a large cohort of coronary artery disease patients.
20227692 Observational study of gene-disease association. (HuGE Navigator)
20156753 there is no significant difference in the distribution of the tested SNPs between subjects with and without chronic obstructive pulmonary disease.
20156753 Observational study of gene-disease association. (HuGE Navigator)
20003279 preliminary results suggest an association between ADAM33 polymorphisms and COPD in a Chinese Han population
20003279 Observational study of gene-disease association. (HuGE Navigator)
19996348 Observational study of gene-disease association. (HuGE Navigator)
19951440 Observational study of gene-disease association. (HuGE Navigator)
19940503 Our findings suggest a relevant role of ADAM33 in thepathogenesis of asthma in this population in Cartagena, Colombia.
19940503 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19665773 Adam33/Adam33 shows 2 significant increments in expression during lung morphogenesis, suggesting important developmental regulation.
19635592 These results support the note that Th2 cytokines can up-regulate the expression of ADAM33 mRNA and ADAM33 may play an important role in the development of airway remodeling in allergen-induced chronic airway inflammation.
19326508 genetic polymorphism is associated with asthma and allergic sensitization in african-americans, hispanics and asians; contradictory data
19317339 This study in a Thai population confirmed a positive association between ADAM33 polymorphisms and asthma susceptibility.
19317339 Observational study of gene-disease association. (HuGE Navigator)
19284602 Adam33 polymorphisms are associated with chronic obstructive pulmonary disease and lung function in long-term tobacco smokers.
19284602 Observational study of gene-disease association. (HuGE Navigator)
19267929 We suggest that ADAM33 promoter methylation may be a useful molecular marker for differentiating invasive lobular carcinoma and invasive ductal carcinoma
19265133 ADAM33 has a key role in gastric cancer pathogenesis by up-regulating the interleukin (IL)-18 secretion process, which results in increased cell migration and proliferation.
19264973 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19237393 Observational study of gene-disease association. (HuGE Navigator)
19236319 Smoke exposure interacts with ADAM33 polymorphisms in the development of lung function and hyperresponsiveness.
19236319 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19146844 First epidemiological study on the relationship between polymorphisms in the ADAM33 gene and the risk of atopic dermatitis. The rs2853209 SNP in the ADAM33 gene was significantly associated with the risk of AD in Japanese children.
19146844 Observational study of gene-disease association. (HuGE Navigator)
18923449 ADAM33, CDKAL1, and PTPN22 may be true psoriasis-risk genes
18923449 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18778489 Polymorphisms of the ADAM33 gene may modify individual susceptibility to AR and AS in a Chinese Han population
18778489 Observational study of gene-disease association. (HuGE Navigator)
18752037 The SNPs (V4 G/C, T2 A/G, T1 G/A, and Q - 1A/G) of the ADAM33 gene may be the causal variants in allergic rhinitis and asthma
18752037 Observational study of gene-disease association. (HuGE Navigator)
18560587 This is the first study that replicates an association between genetic variants in ADAM33 and psoriasis. Interestingly, 2 ADAM33 SNPs associated with psoriasis in this analysis were part of the 3-SNPs haplotypes showing the strongest associations earlier
18425216 Observational study of gene-disease association. (HuGE Navigator)
18423563 The ADAM33 gene contains a regulatory CpG island within its promoter, the methylation status of which tightly controls its expression in a cell type-specific manner
18410963 The discovery that sADAM33 promotes angiogenesis defines it as a tissue remodeling gene with potential to affect airflow obstruction and lung function independently of inflammation
17961406 Met764Thr locus polymorphism of ADAM33 is associated with susceptibility of asthma and clinical indexes of lung function of asthmatic subjects of Han nationality in Southern China.
17961406 Observational study of gene-disease association. (HuGE Navigator)
17878941 identification of ADAM33 as a psoriasis susceptibility gene identified by positional cloning in an outbred population should provide insights into the pathogenesis and natural history of this common disease
17878941 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17702965 Observational study of gene-disease association. (HuGE Navigator)
17702965 No consistent association was found between ADAM33 and asthma susceptibility.
17640346 The data provide for the first time a functional role for a disease-associated SNP in ADAM33 and begin to shed light on the deregulation of this gene in the pathophysiology of asthma
17545039 The polymorphism of T(1) locus allele in ADAM33 gene is associated with the susceptibility to asthma in South China Han population.
17545039 Observational study of gene-disease association. (HuGE Navigator)
17339047 ADAM33 may contribute to the airway remodeling process that occurs with asthma progression.
17061022 Observational study of gene-disease association. (HuGE Navigator)
17061022 Sequence variations in ADAM33 are associated with susceptibility to aspirin-intolerant asthama in the Japanese population.
16893396 Observational study of gene-disease association. (HuGE Navigator)
16893396 No significant association was detected between three SNPs of ADAM33 and asthma susceptibility in the Chinese population
16839403 Observational study of gene-disease association. (HuGE Navigator)
16799089 The ability to identify novel disease genes by positional cloning led to the identification of a disintegrin and metalloprotease (ADAM)33 gene on chromosome 20p13 as a susceptibility gene for asthma.
16784537 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16773130 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16650044 Observational study of gene-disease association. (HuGE Navigator)
16519819 Observational study of gene-disease association. (HuGE Navigator)
16387804 ADAM33 is associated with asthma development, and the levels of ADAM protein are related to asthma severity.
16024651 Observational study of gene-disease association. (HuGE Navigator)
15986064 Observational study of gene-disease association. (HuGE Navigator)
15879414 Observational study of gene-disease association. (HuGE Navigator)
15879414 SNPs in ADAM33 are associated with accelerated lung function decline in the general population.
15805180 Observational study of gene-disease association. (HuGE Navigator)
15805180 Polymorphisms in ADAM33 predict impaired early-life lung function. The functionally relevant polymorphism is likely to be at the 5' end of the gene.
15790980 Meta-analysis of gene-disease association. (HuGE Navigator)
15766253 A substrate specificity profile is established for ADAM33, and enzymatic characterization of the metalloproteinase is reported.
15709049 Occurrence of ADAM33 in embryonic mesenchymal cells suggests that it may be involved in airway wall "remodeling" that contributes to the early life origins of asthma.
15387895 ADAM33 might play a key role in predisposing to the reduced lung function characteristic of asthma, possibly by influencing airway wall remodelling.
15347848 ADAM33 constitutes a novel asthma susceptibility gene.
15298558 Observational study of gene-disease association. (HuGE Navigator)
15196271 Observational study of gene-disease association. (HuGE Navigator)
15144468 Observational study of gene-disease association. (HuGE Navigator)
14742294 Several protein isoforms of ADAM33 are expressed in primary airways fibroblasts, suggesting that it is a complex molecule that plays multiple roles within mesenchymal cells.
14720258 Observational study of gene-disease association. (HuGE Navigator)
14676211 analysis of the catalytic properties of ADAM33
14659745 the crystal structure of the Adam33 catalytic domain in complex with the inhibitor marimastat reveals that the polypeptide fold and active site environment resemble that of other metalloproteases, but the substrate-binding site contains unique features
14564349 Observational study of gene-disease association. (HuGE Navigator)
14564349 This gene (and perhaps others that interact with it) is important in development and pathogenesis of asthma in these 4 asthma populations.
12768445 Novel polymorphisms were identified in ADAM33.
12535637 Data describe the expression and processing of ADAM33
12110844 genome-wide scan on 460 Caucasian families identified a locus on chromosome 20p13 that was linked to asthma (log(10) of the likelihood ratio (LOD), 2.94) and bronchial hyperresponsiveness (LOD, 3.93)
11814695 The human protein shows homology with Xenopus ADAM13 (44%), human ADAM19 (40%), and human ADAM12 (39%).

AA Sequence

MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVAL      1 - 70
EAEGQELLLELEKNHRLLAPGYIETHYGPDGQPVVLAPNHTDHCHYQGRVRGFPDSWVVLCTCSGMSGLI     71 - 140
TLSRNASYYLRPWPPRGSKDFSTHEIFRMEQLLTWKGTCGHRDPGNKAGMTSLPGGPQSRGRREARRTRK    141 - 210
YLELYIVADHTLFLTRHRNLNHTKQRLLEVANYVDQLLRTLDIQVALTGLEVWTERDRSRVTQDANATLW    211 - 280
AFLQWRRGLWAQRPHDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMAHEIGHS    281 - 350
LGLSHDPDGCCVEAAAESGGCVMAAATGHPFPRVFSACSRRQLRAFFRKGGGACLSNAPDPGLPVPPALC    351 - 420
GNGFVEAGEECDCGPGQECRDLCCFAHNCSLRPGAQCAHGDCCVRCLLKPAGALCRQAMGDCDLPEFCTG    421 - 490
TSSHCPPDVYLLDGSPCARGSGYCWDGACPTLEQQCQQLWGPGSHPAPEACFQVVNSAGDAHGNCGQDSE    491 - 560
GHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLDLLGLGLVEPGTQ    561 - 630
CGPRMVCQSRRCRKNAFQELQRCLTACHSHGVCNSNHNCHCAPGWAPPFCDKPGFGGSMDSGPVQAENHD    631 - 700
TFLLAMLLSVLLPLLPGAGLAWCCYRLPGAHLQRCSWGCRRDPACSGPKDGPHRDHPLGGVHPMELGPTA    701 - 770
TGQPWPLDPENSHEPSSHPEKPLPAVSPDPQADQVQMPRSCLW                               771 - 813
//

Text Mined References (130)

PMID Year Title
26666372 2016 Genetic variants of ADAM33 are associated with asthma susceptibility in the Punjabi population of Pakistan.
26553447 2016 ADAM33 and ADAM12 genetic polymorphisms and their expression in Egyptian children with asthma.
26291893 2015 The ADAM33 S2 polymorphism is associated with susceptibility to pediatric asthma in the Chinese Han population.
25840998 2015 Compartment-specific expression of collagens and their processing enzymes in intrapulmonary arteries of IPAH patients.
25768087 2015 An ADAM33 polymorphism associates with progression of preschool wheeze into childhood asthma: a prospective case-control study with replication in a birth cohort study.
25739290 2014 [Analysis of polymorphisms of genes associated with immune response and tissue remodeling in occupational chronic bronchitis].
25730038 2015 Association between V4 polymorphism in the ADAM33 gene and asthma risk: a meta-analysis.
25453333 2014 The roles of ADAM33, ADAM28, IL-13 and IL-4 in the development of lung injuries in children with lethal non-pandemic acute infectious pneumonia.
25416956 2014 A proteome-scale map of the human interactome network.
25369941 2014 Genetic variants in ADAM33 are associated with airway inflammation and lung function in COPD.
25313536 2014 Association between ADAM33 polymorphisms and susceptibility with adult and childhood asthma among Jordanians.
25280544 2015 Association of a disintegrin and metalloprotease 33 (ADAM33) gene polymorphisms with the risk of COPD: an updated meta-analysis of 2,644 cases and 4,804 controls.
25158257 2014 Association of a disintegrin and metalloproteinase 33 (ADAM33) gene polymorphisms with chronic obstructive pulmonary disease in the Chinese population: a meta-analysis.
25155083 2014 Molecular interaction network and pathway studies of ADAM33 potentially relevant to asthma.
25068505 2014 Association between genetic polymorphisms in the ADAM33 gene and asthma risk: a meta-analysis.
25036518 2014 Association between polymorphisms in ADAM33, CD14, and TLR4 with asthma in the Uygur population in China.
24751681 2014 Association study on ADAM33 polymorphisms in mite-sensitized persistent allergic rhinitis in a Chinese population.
24728305 2014 ADAM33 gene polymorphisms are associated with the risk of idiopathic pulmonary fibrosis.
24562625 2014 Association of ADAM33 gene polymorphisms with psoriasis in a northeastern Chinese population.
24422987 2014 Polymorphisms in a disintegrin and metalloprotease 33 gene and the risk of chronic obstructive pulmonary disease: a meta-analysis.
24191661 Association of ADAM33 gene polymorphisms with COPD in the Mongolian population of China.
24141861 2013 ADAM33 polymorphisms are associated with asthma and a distinctive palm dermatoglyphic pattern.
24035932 2013 Frequency of genetic polymorphisms of ADAM33 and their association with allergic rhinitis among Jordanians.
23902466 2014 Polymorphisms of the ADAM33 gene and chronic obstructive pulmonary disease risk: a meta-analysis.
23861802 2013 ADAM33 gene polymorphisms and mortality. A prospective cohort study.
23640557 2013 Increased expression of ADAM33 protein in asthmatic patients as compared to non-asthmatic controls.
23640030 2013 Possible control of paternal imprinting of polymorphisms of the ADAM33 gene by epigenetic mechanisms and association with level of airway hyperresponsiveness in asthmatic children.
23612257 2013 Association between ADAM33 S2 and ST+4 polymorphisms and susceptibility to asthma: a meta-analysis.
23525950 2013 Single-nucleotide polymorphisms of allergy-related genes and risk of adult glioma.
23380143 2013 A disintegrin and metalloprotease 33 (ADAM33) gene polymorphisms and the risk of asthma: a meta-analysis.
23331525 2013 Asthma severity, polymorphisms in 20p13 and their interaction with tobacco smoke exposure.
23257708 2013 The methylation patterns of a disintegrin and metalloproteinase 33 gene (ADAM33) in adult asthma.
23245479 2012 The association between the IL-4, ADR?2 and ADAM 33 gene polymorphisms and asthma in the Taiwanese population.
22989201 Haplotypic association of ADAM33 (T+1, S+1 and V - 3) gene variants in genetic susceptibility to asthma in Indian population.
22888638 [Association of the MMP3, MMP9, ADAM33 and TIMP3 genes polymorphic markers with development and progression of chronic obstructive pulmonary disease].
22871616 T1 and T2 ADAM33 single nucleotide polymorphisms and the risk of childhood asthma in a Saudi Arabian population: a pilot study.
22851202 2012 Association between ADAM33 T1 polymorphism and susceptibility to asthma in Asians.
22660217 2012 Association of STAT6 and ADAM33 single nucleotide polymorphisms with asthma bronchiale and IgE level and its possible epigenetic background.
22583515 2012 ADAM33 polymorphisms, smoking and asthma in Japanese women: the Kyushu Okinawa Maternal and Child Health Study.
22349453 2012 ADAM33 genetic polymorphisms, smoking, and rhinoconjunctivitis in Japanese women: the Kyushu Okinawa Maternal and Child Health Study.
22269827 2011 ADAM33 as a psoriasis susceptibility gene in the Han population of northeastern China.
22227561 2012 Regulation of a disintegrin and metalloprotease-33 expression by transforming growth factor-?.
22035178 2011 ADAM33 gene polymorphisms associate with asthma susceptibility and severity in East China han population.
21930123 2011 Association of ADAM33 polymorphisms with childhood asthma in a northern Chinese population.
21869474 2011 Association of ADAM33 gene polymorphisms with adult-onset asthma and its severity in an Indian adult population.
21781516 2011 [Inhibition of 1,25-(OH)2D3 on passively sensitized human airway smooth muscle cells].
21689380 2013 Association of ADAM33 gene polymorphisms with asthma in a Chinese population.
21618342 2011 Analysis of the disintegrin-metalloproteinases family reveals ADAM29 and ADAM7 are often mutated in melanoma.
21179102 2011 Association of ADAM33 gene polymorphisms with asthma in Indian children.
21161400 2011 Association of ADAM33 gene with susceptibility to COPD in Tibetan population of China.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
20701904 2010 Early life environment, neurodevelopment and the interrelation with atopy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20537279 Expression of a disintegrin and metalloproteinase 33 protein in nasal polyposis: an immunohistochemical study.
20524005 2010 Association of IL-4 and ADAM33 gene polymorphisms with asthma in an Indian population.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20491578 2010 Association of ADAM33 polymorphisms and susceptibility to psoriasis.
20395963 2010 Replication of genetic association studies in asthma and related phenotypes.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20227692 2010 ADAM33 expression in atherosclerotic lesions and relationship of ADAM33 gene variation with atherosclerosis.
20156753 2009 ADAM33 gene polymorphisms in chronic obstructive pulmonary disease.
20003279 2009 Association of ADAM33 gene polymorphisms with COPD in a northeastern Chinese population.
19996348 2010 Positionally cloned genes and age-specific effects in asthma and atopy: an international population-based cohort study (ECRHS).
19951440 2009 Analyses of associations between three positionally cloned asthma candidate genes and asthma or asthma-related phenotypes in a Chinese population.
19940503 2010 A Six-SNP haplotype of ADAM33 is associated with asthma in a population of Cartagena, Colombia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19665773 2009 Induction of a disintegrin and metalloprotease 33 during embryonic lung development and the influence of IL-13 or maternal allergy.
19635592 2009 The effects of Th2 cytokines on the expression of ADAM33 in allergen-induced chronic airway inflammation.
19326508 2009 Asthma and ethnic minorities: socioeconomic status and beyond.
19317339 2008 Association between ADAM33 polymorphisms and asthma in a Thai population.
19284602 2009 Adam33 polymorphisms are associated with COPD and lung function in long-term tobacco smokers.
19267929 2009 ADAM33 gene silencing by promoter hypermethylation as a molecular marker in breast invasive lobular carcinoma.
19265133 2009 Expression of ADAM33 is a novel regulatory mechanism in IL-18-secreted process in gastric cancer.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19237393 2009 Positionally cloned asthma susceptibility gene polymorphisms and disease risk in the British 1958 Birth Cohort.
19236319 2009 Smoke exposure interacts with ADAM33 polymorphisms in the development of lung function and hyperresponsiveness.
19146844 2009 ADAM33 genetic polymorphisms and risk of atopic dermatitis among Japanese children.
18923449 2009 Further genetic evidence for three psoriasis-risk genes: ADAM33, CDKAL1, and PTPN22.
18778489 2008 Association of ADAM33 gene polymorphisms with adult allergic asthma and rhinitis in a Chinese Han population.
18752037 2009 Association of ADAM33 gene polymorphisms with adult concomitant allergic rhinitis and asthma in Chinese Han population.
18560587 2008 Replication of association between ADAM33 polymorphisms and psoriasis.
18425216 Association of TGF-beta1, CD14, IL-4, IL-4R and ADAM33 gene polymorphisms with asthma severity in children and adolescents.
18423563 2008 Epigenetic mechanisms silence a disintegrin and metalloprotease 33 expression in bronchial epithelial cells.
18410963 2008 The soluble form of a disintegrin and metalloprotease 33 promotes angiogenesis: implications for airway remodeling in asthma.
17961406 2007 [Association of polymorphism of Met764Thr locus allele in ADAM33 gene with bronchial asthma and lung function of asthmatic subjects].
17878941 2007 ADAM33, a new candidate for psoriasis susceptibility.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17702965 2007 Comprehensive testing of positionally cloned asthma genes in two populations.
17640346 2007 Mechanistic role of a disease-associated genetic variant within the ADAM33 asthma susceptibility gene.
17545039 2007 [Association between ADAM33 gene polymorphism and bronchial asthma in South China Han population].
17339047 2007 Increased expression of ADAM33 and ADAM8 with disease progression in asthma.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17061022 2007 ADAM33 polymorphisms are associated with aspirin-intolerant asthma in the Japanese population.
16893396 2006 Lack of association between ADAM33 gene and asthma in a Chinese population.
16839403 2006 Association between ADAM33 polymorphisms and adult asthma in the Japanese population.
16799089 2006 The genetics of asthma: ADAM33 as an example of a susceptibility gene.
16784537 2006 The role of polymorphisms in ADAM33, a disintegrin and metalloprotease 33, in childhood asthma and lung function in two German populations.
16773130 2006 ADAM33 haplotypes are associated with asthma in a large Australian population.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16650044 2006 ADAM33 polymorphisms are associated with asthma susceptibility in a Japanese population.
16519819 2006 Analysis of polymorphisms in 16 genes in type 1 diabetes that have been associated with other immune-mediated diseases.
16387804 2006 A disintegrin and metalloproteinase 33 protein in patients with asthma: Relevance to airflow limitation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16024651 2005 Polymorphisms associated with asthma are inversely related to glioblastoma multiforme.
15986064 2005 Asthma severity and genetics in Taiwan.
15879414 2005 A disintegrin and metalloprotease 33 polymorphisms and lung function decline in the general population.
15805180 2005 Polymorphisms in a disintegrin and metalloprotease 33 (ADAM33) predict impaired early-life lung function.
15790980 2005 Contribution of ADAM33 polymorphisms to the population risk of asthma.
15766253 2005 ADAM33 enzyme properties and substrate specificity.
15709049 2005 ADAM33 expression in asthmatic airways and human embryonic lungs.
15387895 2004 The discovery and role of ADAM33, a new candidate gene for asthma.
15347848 2004 ADAM 33 and its association with airway remodeling and hyperresponsiveness in asthma.
15298558 2004 Polymorphisms in ADAM33 are associated with allergic rhinitis due to Japanese cedar pollen.
15196271 2004 ADAM33 polymorphism: association with bronchial hyper-responsiveness in Korean asthmatics.
15144468 2004 Polymorphisms of the ADAM33 gene are associated with accelerated lung function decline in asthma.
14742294 2004 The splicing and fate of ADAM33 transcripts in primary human airways fibroblasts.
14720258 2004 Asthma is associated with single-nucleotide polymorphisms in ADAM33.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676211 2004 Catalytic activity of human ADAM33.
14659745 2004 Crystal structure of the catalytic domain of human ADAM33.
14564349 2003 Association of a disintegrin and metalloprotease 33 (ADAM33) gene with asthma in ethnically diverse populations.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12768445 2003 Identification of novel polymorphisms in the Adam33 gene.
12535637 2003 Human ADAM33: protein maturation and localization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110844 2002 Association of the ADAM33 gene with asthma and bronchial hyperresponsiveness.
11814695 2002 Identification and characterization of novel mouse and human ADAM33s with potential metalloprotease activity.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.