Property Summary

Ligand Count 10
NCBI Gene PubMed Count 134
PubMed Score 159.59
PubTator Score 198.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.300 3.1e-02
Atopic dermatitis -1.200 1.7e-03
Breast cancer -3.900 2.2e-02
breast carcinoma -1.200 1.0e-05
cystic fibrosis -1.651 1.0e-03
ductal carcinoma in situ -1.400 1.4e-04
ependymoma 1.400 3.2e-02
glioblastoma -1.200 1.9e-04
group 4 medulloblastoma -1.200 9.1e-04
invasive ductal carcinoma -1.752 2.3e-03
medulloblastoma, large-cell -1.500 2.2e-05
oligodendroglioma 1.400 1.8e-02
osteosarcoma 1.117 4.7e-04
pancreatic ductal adenocarcinoma liver m... 1.845 4.6e-04

Gene RIF (148)

AA Sequence

MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVAL      1 - 70
EAEGQELLLELEKNHRLLAPGYIETHYGPDGQPVVLAPNHTDHCHYQGRVRGFPDSWVVLCTCSGMSGLI     71 - 140
TLSRNASYYLRPWPPRGSKDFSTHEIFRMEQLLTWKGTCGHRDPGNKAGMTSLPGGPQSRGRREARRTRK    141 - 210
YLELYIVADHTLFLTRHRNLNHTKQRLLEVANYVDQLLRTLDIQVALTGLEVWTERDRSRVTQDANATLW    211 - 280
AFLQWRRGLWAQRPHDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMAHEIGHS    281 - 350
LGLSHDPDGCCVEAAAESGGCVMAAATGHPFPRVFSACSRRQLRAFFRKGGGACLSNAPDPGLPVPPALC    351 - 420
GNGFVEAGEECDCGPGQECRDLCCFAHNCSLRPGAQCAHGDCCVRCLLKPAGALCRQAMGDCDLPEFCTG    421 - 490
TSSHCPPDVYLLDGSPCARGSGYCWDGACPTLEQQCQQLWGPGSHPAPEACFQVVNSAGDAHGNCGQDSE    491 - 560
GHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLDLLGLGLVEPGTQ    561 - 630
CGPRMVCQSRRCRKNAFQELQRCLTACHSHGVCNSNHNCHCAPGWAPPFCDKPGFGGSMDSGPVQAENHD    631 - 700
TFLLAMLLSVLLPLLPGAGLAWCCYRLPGAHLQRCSWGCRRDPACSGPKDGPHRDHPLGGVHPMELGPTA    701 - 770
TGQPWPLDPENSHEPSSHPEKPLPAVSPDPQADQVQMPRSCLW                               771 - 813
//

Text Mined References (135)

PMID Year Title