Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.85
PubTator Score 24.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.100 1.0e-04
astrocytic glioma -1.800 2.2e-02
posterior fossa group A ependymoma -2.900 1.8e-14
osteosarcoma -2.603 2.1e-03
glioblastoma -2.700 1.7e-04
group 4 medulloblastoma -1.900 3.7e-05
atypical teratoid / rhabdoid tumor -2.200 3.5e-05
medulloblastoma, large-cell -2.900 2.3e-05
primitive neuroectodermal tumor -1.200 2.6e-03
Amyotrophic Lateral Sclerosis 1.437 5.2e-09
adrenocortical carcinoma 1.066 3.8e-02
non-small cell lung cancer 1.566 1.2e-07
diabetes mellitus -1.300 6.4e-03
pediatric high grade glioma -2.200 3.9e-05
nasopharyngeal carcinoma 2.600 2.3e-03
lung carcinoma 1.400 7.7e-10
Pick disease -2.200 3.0e-03
pituitary cancer 2.200 4.6e-05
psoriasis 1.900 1.0e-105

Gene RIF (14)

PMID Text
26800504 Our data provide evidence that ADAM23 plays a role in suppression of cancer cell progression through interaction with aVb3 integrin, and suggest that downregulation of ADAM23 in SP cells may contribute toward providing a cancer stem cell phenotype
25740824 High ADAM23 gene methylation is associated with gastric tumor aggressiveness.
25620615 quantification of CXCL12 and ADAM23 methylation could be useful for the prediction of advanced stage of BC
24662834 Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals.
23898208 HIV-1 Tat downregulates the expression of ADAM metallopeptidase domain 23 (ADAM23) in human primary T cells
21429053 The expression level of ADAM23 is likely to be involved in the progression of non-small-cell lung carcinoma, and its downregulation is probably correlated with promoter methylation.
20851106 a SP1 binding site (-202/-190) that binds SP1 at the proximal promoter of human ADAM23 gene was indentified.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19824886 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19549921 Functional role of ADAM23 during lung caner metastatic progression by negatively modulating alpha(v)beta(3) integrin activation.
19477226 PrP(C) is a novel molecular partner for ADAM23 in the nervous systems.
19089928 ADAM23 may be down-regulated by aberrant promoter hypermethylation during the progression of colorectal cancer.
16103878 ADAM23 is frequently silenced in gastric cancers by homozygous deletion or aberrant promoter methylation.
15862898 Together, these results indicate that ADAM23 down-regulation by methylation in brain tumors is a rare event and it may help explain why brain tumor metastases are rarely found elsewhere in the body.

AA Sequence

MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASSRPRAWGAAAP      1 - 70
SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQ     71 - 140
KHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKV    141 - 210
ALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQW    211 - 280
LKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAV    281 - 350
ETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG    351 - 420
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGA    421 - 490
CLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYEC    491 - 560
RDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKL    561 - 630
NTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLD    631 - 700
DDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSI    701 - 770
RDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI            771 - 832
//

Text Mined References (27)

PMID Year Title
26800504 2016 ADAM23 is downregulated in side population and suppresses lung metastasis of lung carcinoma cells.
25740824 2015 Epigenetic clustering of gastric carcinomas based on DNA methylation profiles at the precancerous stage: its correlation with tumor aggressiveness and patient outcome.
25620615 2015 CXCL12 and ADAM23 hypermethylation are associated with advanced breast cancers.
24662834 2015 Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals.
22937229 2011 ADAM23, a Gene Related to LGI1, Is Not Linked to Autosomal Dominant Lateral Temporal Epilepsy.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
21429053 2011 The expression of ADAM23 and its correlation with promoter methylation in non-small-cell lung carcinoma.
20851106 2010 SP1 acts as a key factor, contributes to upregulation of ADAM23 expression under serum deprivation.
20463223 2010 LGI1 is a Nogo receptor 1 ligand that antagonizes myelin-based growth inhibition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19824886 2009 Association and interaction analyses of eight genes under asthma linkage peaks.
19549921 2009 ADAM23 negatively modulates alpha(v)beta(3) integrin activation during metastasis.
19477226 2009 Characterization of a specific interaction between ADAM23 and cellular prion protein.
19089928 2009 Promoter hypermethylation of the ADAM23 gene in colorectal cancer cell lines and cancer tissues.
16103878 2005 ADAM23, a possible tumor suppressor gene, is frequently silenced in gastric cancers by homozygous deletion or aberrant promoter hypermethylation.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15862898 2005 ADAM23 methylation and expression analysis in brain tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14697522 2004 Two novel isoforms of Adam23 expressed in the developmental process of mouse and human brains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10749942 2000 ADAM 23/MDC3, a human disintegrin that promotes cell adhesion via interaction with the alphavbeta3 integrin through an RGD-independent mechanism.
10524237 1999 The identification of seven metalloproteinase-disintegrin (ADAM) genes from genomic libraries.
9693107 1998 Metalloproteinase-like, disintegrin-like, cysteine-rich proteins MDC2 and MDC3: novel human cellular disintegrins highly expressed in the brain.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.