Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.57
PubTator Score 3.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 4 medulloblastoma 1875 8.1e-06
medulloblastoma, large-cell 6234 5.3e-04
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Brachydactyly 52 3.337 1.7
Atrial heart septal defect 15 3.104 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 5.3e-04
group 4 medulloblastoma 1.200 8.1e-06

 MGI Phenotype (1)

AA Sequence

MAVDGTLVYIRVTLLLLWLGVFLSISGYCQAGPSQHFTSPEVVIPLKVISRGRSAKAPGWLSYSLRFGGQ      1 - 70
KHVVHMRVKKLLVSRHLPVFTYTDDRALLEDQLFIPDDCYYHGYVEAAPESLVVFSACFGGFRGVLKISG     71 - 140
LTYEIEPIRHSATFEHLVYKINSNETQFPAMRCGLTEKEVARQQLEFEEAENSALEPKSAGDWWTHAWFL    141 - 210
ELVVVVNHDFFIYSQSNISKVQEDVFLVVNIVDSMYKQLGTYIILIGIEIWNQGNVFPMTSIEQVLNDFS    211 - 280
QWKQISLSQLQHDAAHMFIKNSLISILGLAYVAGICRPPIDCGVDNFQGDTWSLFANTVAHELGHTLGMQ    281 - 350
HDEEFCFCGERGCIMNTFRVPAEKFTNCSYADFMKTTLNQGSCLHNPPRLGEIFMLKRCGNGVVEREEQC    351 - 420
DCGSVQQCEQDACCLLNCTLRPGAACAFGLCCKDCKFMPSGELCRQEVNECDLPEWCNGTSHQCPEDRYV    421 - 490
QDGIPCSDSAYCYQKRCNNHDQHCREIFGKDAKSASQNCYKEINSQGNRFGHCGINGTTYLKCHISDVFC    491 - 560
GRVQCENVRDIPLLQDHFTLQHTHINGVTCWGIDYHLRMNISDIGEVKDGTVCGPGKICIHKKCVSLSVL    561 - 630
SHVCLPETCNMKGICNNKHHCHCGYGWSPPYCQHRGYGGSIDSGPASAKRGVFLPLIVIPSLSVLTFLFT    631 - 700
VGLLMYLRQCSGPKETKAHSSG                                                    701 - 722
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10524237 1999 The identification of seven metalloproteinase-disintegrin (ADAM) genes from genomic libraries.
9469942 1998 ADAM 20 and 21; two novel human testis-specific membrane metalloproteases with similarity to fertilin-alpha.